KEGG   Lactobacillus paracasei ATCC 334: LSEI_2027Help
Entry
LSEI_2027         CDS       T00407                                 

Definition
(RefSeq) Gmk, guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lca  Lactobacillus paracasei ATCC 334
Pathway
lca00230  Purine metabolism
lca01100  Metabolic pathways
Module
lca_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lca00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LSEI_2027
Enzymes [BR:lca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LSEI_2027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 T2SSE AAA_28 SRP54 ABC_tran AAA_30 CoaE AAA_16 AAA_33 AAA_23 DUF3391 ResIII NTPase_1 AAA_19 AAA_25
Motif
Other DBs
NCBI-GeneID: 4420574
NCBI-ProteinID: YP_807224
UniProt: Q036U0
Position
complement(2004311..2004913)
Genome map
AA seq 200 aa AA seqDB search
MKAAHKLIVITGATGTGKTTVSGYLRDNYRIHRVMTHTTRPARTGEKNGVDYYFETPASF
ATKHFIEKVTYAGYEYGSSHESLEKNWTKHPFLSIVLDTKGAITYVRELPKEVVVLFLTI
DNPTVLKDRLLSRGDDPAMVAARLKSPEYKRDLTLPNELKPFATVIKNDSWDEAREQVDQ
FMKTLALKSCVLARIDLEQK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcgcataagttgattgtgatcactggggcaacagggactggcaaaacgacg
gtgagtggttatcttcgcgataattatcgcatccaccgcgtgatgacgcacaccacccgt
ccggcgcgcacaggggaaaagaatggggtcgattactatttcgaaacaccggcgagtttt
gcgaccaaacattttatcgaaaaagtcacttatgctggttatgagtacggttcctcccat
gaatcgcttgaaaaaaactggaccaagcatcccttccttagtattgttctagacacaaaa
ggtgccattacctatgtgcgtgagttgccaaaggaggtcgtggtcttatttttaacaatt
gataacccaacggtattaaaagatcggttgttgagccgtggtgacgatcctgccatggtt
gctgcgcggttgaaaagtccggaatataagcgcgatttaaccttgccaaacgaactaaag
ccgtttgccactgtgatcaaaaatgacagttgggatgaggcacgcgagcaagtggatcaa
tttatgaaaaccttggctttgaaaagttgcgtccttgcccgcatcgatttagaacaaaaa
taa

DBGET integrated database retrieval system