KEGG   Lactobacillus casei ATCC 334: LSEI_2040Help
Entry
LSEI_2040         CDS       T00407                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
lca  Lactobacillus casei ATCC 334
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lca00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LSEI_2040
Enzymes [BR:lca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     LSEI_2040
Exosome [BR:lca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LSEI_2040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2021458..2023557)
Genome map
AA seq 699 aa AA seqDB search
MIQGLKDWLYLFNSGQDFQSYNRFGAHEVEPGKWSFLVWAPHAQQVNVEGDFNDWQGSPL
KLQGTTGCWYGELAAEKNQLYKYRIIGPDGIAHEKIDPYGFGFERKPGSAAKLVDVPRIT
WHDEDWLAKRAKWRPYDEPLNIYEVHLGSFIRDTNAGPDGGYMTYQDAIDKLIPYVQELG
YTHIEFLPLMEHPLDASWGYQLMGYFAPTSRFGDPQDFLRLVDAAHTAGLGVIMDWVPGH
FIKNTDMLAQFDGTPTFEYTDPHRAENVRWGTWNFDLGKAQVQSFLISSAMYWLDHCHLD
GLRVDAVSNMLYMDYDAGKENDRNKDGGRDNLEGIAFIKQLNTKIFAKHPDVLMMAEESS
AYPQVSAPIDTGGLGFNYKWNMGWMNDTLKFFEQDPVYRHSDMNLLTFSFMYMYNEQFVL
PFSHDEVVHGKKSLMHKMPGDRYNQFANLRTMYVWQATFPGKQLLFMGSEWGQFLEWRDW
SELEWTDLKDPMNKKMQHFTTTLNHLYKARPSLWQQDHEPDGIKITIADEPDVLSYIRYG
KQKDDFTVVAMNLVPVQKDHFRVPVPSPGTYEIILNTEDAAFGGTWTKWQQTLTAEIGEN
HDVPAWLDVILPAMGALLIKPKQLKSLPKKPLALKGKQPTKALPRHETPLSLAGHQRQPI
SHQDDWGTSPARSQPRDISKVNHQQSKKLGGKAHNAPQS
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgattcagggattaaaagattggttatacctcttcaactccgggcaagattttcaaagt
tacaatcggtttggcgcccatgaagtcgaaccaggcaagtggtccttcctcgtttgggca
ccgcatgcccaacaagtcaacgtcgaaggcgacttcaacgactggcaaggcagtccgttg
aaactgcaaggcaccaccggttgttggtacggtgagcttgccgccgaaaagaatcagtta
tacaagtatcggattatcggtcctgatgggatagcccatgagaagattgatccatacggg
tttgggtttgaacgcaagccaggcagtgcggctaagttggtcgatgtgccgcgcattact
tggcatgatgaagattggctagccaagcgggcaaaatggcgcccgtatgatgaaccgctt
aatatttacgaagtccacttaggctccttcattcgcgacaccaatgccggtccagatggc
ggctatatgacgtatcaagacgccattgacaagctgatcccttatgtgcaggagttgggc
tacacccacattgagtttttaccgttgatggagcatccgcttgacgcttcatggggctat
cagttaatgggttacttcgcgccgacgagccggttcggcgatccgcaagacttcttgcgg
ttggtcgatgcggctcacacagcaggattaggcgtcatcatggactgggtaccggggcat
ttcatcaaaaataccgatatgttggcccaatttgatggcacgccaaccttcgaatacacc
gatccgcaccgcgcagaaaatgtccgctgggggacttggaacttcgatcttggcaaggca
caagtgcagagtttcttaatttccagtgcgatgtattggttggatcactgccaccttgat
ggcctgcgggttgatgctgtctcgaacatgttgtacatggattatgacgctggcaaagaa
aacgatcgcaacaaggatggtgggcgtgacaaccttgaaggcattgcctttatcaagcaa
ttgaatacaaagatttttgccaaacatccagatgtgctcatgatggctgaagaaagctcc
gcctatccgcaagtttcagcaccgattgatactggcggcttagggtttaactacaagtgg
aacatgggctggatgaatgacacgctgaagttcttcgagcaggatccggtttatcgccac
agtgatatgaatttattgacgttttcattcatgtatatgtataacgagcaattcgtctta
ccgttttcacacgatgaagttgtccatggcaaaaagagcctgatgcacaaaatgccggga
gatcggtataaccagtttgctaatctccggacgatgtatgtgtggcaggcaacattccct
ggtaaacagctattattcatgggcagcgagtgggggcagtttcttgaatggcgcgactgg
agcgagctggaatggaccgatcttaaagacccaatgaataagaagatgcagcatttcacc
accacactgaatcatctttataaagctcggccaagtttgtggcaacaagatcatgaaccc
gacggcatcaaaatcacgattgccgatgaaccggatgtgctgagttacatccgttatggc
aaacaaaaagatgactttacggtagtggccatgaatctggtgccagttcaaaaagatcat
ttccgtgtgccagttcctagtccgggaacgtacgagattattttaaatactgaggatgcg
gcttttggcggtacatggaccaagtggcagcagactttgactgctgagattggcgaaaac
catgacgttcctgcatggcttgacgtcattttaccagccatgggcgctttgttgattaaa
ccaaaacagctgaagtcgttgccgaaaaaaccgttggcacttaaaggcaagcagccaacc
aaggcattaccgagacatgaaacaccgttgtcactcgccggtcatcaacggcaaccgatt
agtcatcaagacgactggggcacatcgccagcgcggtcgcaaccacgtgacattagcaaa
gttaaccatcagcaatcgaagaagttaggggggaaggcgcacaatgcgccgcaatcatga

DBGET integrated database retrieval system