KEGG   Lactobacillus casei ATCC 334: LSEI_2082Help
Entry
LSEI_2082         CDS       T00407                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lca  Lactobacillus casei ATCC 334
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lca00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LSEI_2082
Enzymes [BR:lca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LSEI_2082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2068331..2070913)
Genome map
AA seq 860 aa AA seqDB search
MANQEQVYENVDLQVIKLLFNSDNGDYKVYAVRILNPNPALKMTLTQEATITGDMGYYNR
RAIITADLVYDDAGSLRYNKPSYKLARLHFGLPKEPRRQWQLIDTLLVHQPTVRRRLHEH
FADDTPILTVFSTDQVKPDSVPGIGPATIKKIATAIRGKLEIAVLANHWGKALSSMTYEK
IWLAYKDANLAMQSIDANPYLLMSVAQLDFKKVDTFAKTRGIAANDPHRLTAGLQYIFRT
AVLTQGLTYITITWFRQQAATLLAVREADLKMFADPQEALQYGFLLNEQYGLVTSCDMFA
TEGSVARIIKVAQKTAEPLMAPDELDDALDQFLDRFHLTINDQQRAAFQNVNHHGLSVLN
GSAGTGKTWLTDLLVRFFNAQAKGKSVLLAPTGRAAKVLAKYTHEPAATIHAYLHLLPGE
ETGQFDADADWETFGDARLIVVDESSMLTTPLAYTVLKNVNFKKAHVLFVGDVFQLPPIG
PGNFLKDCLDDEQVAATTLTRVYRQDSQSGVLALANRIRDRLALPFGPDDDRYVSGNVAL
YNQRNAGRVFDAGVKAYQDALVKSGQQIDAQLLIVNKNIGATGRLRFNAELQALVNPAKN
GEPEYISSYVDPVTNQKHHLRLNDRVMILKNDKHVPLVDPKTWERRAVLGENGLQQTDDF
GTKRWRETIVANGDTGVVAHIDTKRHFVVVQIGKQYCYYSFGSVPRDLTLAYAITVHKAQ
GGQADTVIAIVNGADMMLNAQSFYTALTRTQQQFIFFGDFRVLLARTKIYPIDARHDLLG
SFLSGQLTVDTFSRYTFDQVLAWLDKRHAERLSTRPALEAEEVIPSEQPFAVRYAEQLDI
LDQIVDEVAQLPARKPARDV
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atggctaatcaggaacaagtttatgaaaatgttgatctgcaagtgatcaagttgctcttt
aatagcgataacggtgattataaagtttacgccgtgcggattctgaatccgaatccggcg
cttaaaatgacgctcacccaagaggcaaccattaccggtgatatgggctactacaatcgc
cgagcgatcatcaccgctgatttggtttacgatgatgctggctcattgcgttataacaag
ccgtcttacaaattggcgcggttgcattttggcttgcccaaagaaccgcgccggcagtgg
cagctgattgacacgttgctggtgcatcagccgacagttcggcgccgattgcatgaacat
tttgcagatgataccccgatcttgacggttttttccaccgatcaggtaaaaccggatagt
gtcccgggcattgggcccgccacaattaagaaaatcgctaccgccatccgcggcaaactg
gaaattgccgtgttggccaatcactggggcaaggcactaagctcaatgacctatgaaaaa
atttggttggcttataaagatgccaatttggccatgcaaagtattgatgccaatccgtac
ctgttgatgtcagttgcccagcttgatttcaagaaagtcgacacctttgctaagacgcgt
ggcattgcagcgaatgatccgcatcggcttacggcaggattgcaatatatttttcgcacg
gctgtactcacgcaaggattgacctatatcaccattacgtggttccggcagcaagctgct
actttattggctgtacgcgaagccgatttgaaaatgtttgctgatccgcaagaagccttg
caatacggctttttacttaacgagcagtatggacttgtgacgagttgcgatatgtttgcc
acagaaggatcggtggcgcggattattaaagtcgctcaaaaaacagccgagccgttgatg
gctccggatgagctagatgatgctctcgatcagtttctcgatcggtttcatttaaccatt
aatgatcaacagcgcgccgcttttcaaaatgtgaaccatcatggcttgagcgttttgaat
ggcagtgctggcaccggtaaaacttggttgaccgatttgctggttcggttttttaacgcc
caagcaaaaggtaaaagtgtcttgcttgcaccaactggccgcgccgccaaagttttggca
aagtatacgcacgagccggctgccacgattcatgcttatctgcatctactgccaggtgaa
gaaaccggccagtttgacgcggatgccgactgggaaacctttggcgatgcgcgactcatt
gtggtggatgaaagctcaatgctgacaacgccgctagcctacacggttttgaagaacgtt
aatttcaaaaaggcacatgtactgtttgtcggtgatgttttccaactgccgcccatcggt
cctggcaactttttaaaagattgtctagacgatgaacaggtggcggcgacaacactgacg
cgcgtttatcggcaagatagccagtccggcgtgttagcactagctaatcgcattcgtgat
cggttagcgctgccttttggaccagacgatgatcgctatgtcagcggcaacgtggcgctg
tataaccaacgcaatgctggccgggtgtttgatgctggggtgaaggcgtatcaggatgcg
ctggtcaaaagtggtcagcagattgatgcgcaattgttgatcgtgaataaaaacatcggc
gcaactggccgcttgcgatttaatgctgagttgcaagcgttggttaacccggctaaaaat
ggcgaaccggagtatatcagcagttacgtggacccggtcactaatcaaaaacatcacttg
cgcctcaatgatcgggtcatgattttgaaaaacgataaacatgtcccgcttgttgatccg
aaaacatgggaacggcgtgcggtgctgggcgaaaatggcttgcaacagaccgatgatttt
ggcactaaacgttggcgtgagacaattgtggcaaacggcgacacaggggtggtagcccat
attgataccaaacgccattttgttgtggtccaaatcggcaagcaatattgttactacagt
tttggcagcgtgccgcgcgatttgacgctggcttatgcgattacggtgcataaggcccaa
ggtgggcaggcagataccgttattgccattgtcaacggcgccgacatgatgctcaacgcc
caaagcttttatacggcgttgacgcgcacccagcagcaattcatcttttttggtgacttt
cgggtgctcttagcccgcaccaaaatctatcccatcgatgctcgccatgatttacttggt
agttttctatccggccaactgacagtcgatacgttcagccgctatacctttgatcaggtc
ttggcttggctggataagcggcacgctgaacgcttatccacgcgacctgcgctggaagca
gaggaagtcataccaagcgagcagccatttgccgttcgttatgcggaacaactggacatc
ttggatcagattgtcgatgaggttgctcaattgccggctagaaaacctgctcgggatgtt
tga

DBGET integrated database retrieval system