KEGG   Lactobacillus casei ATCC 334: LSEI_2150Help
Entry
LSEI_2150         CDS       T00407                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lca  Lactobacillus casei ATCC 334
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LSEI_2150
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LSEI_2150
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LSEI_2150
Enzymes [BR:lca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LSEI_2150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2139169..2140683)
Genome map
AA seq 504 aa AA seqDB search
MRYTSTRDHQVSKTSKEAIKQGISEEGGLFVLPHLADQTLNIHELLDLDYETIAQRVLMI
LLPDFNTDSLKKAIHFAYHQHFSDDRITPVRSVGDFHVLELFHGPTSAFKDVGLQLLPRL
MQLALDPDDRVMILAATSGDTGTAALQGFKDVAQTGITVFYPNHGVSPIQERQMLTVGSD
NTRVFPIAGNFDQAQSAVKTLFTDTSFAARLQAEQVTLSAANSINIGRLIPQVVYYFAAY
SQLVKAQAISMGDEVNFTVPTGNFGDVLAGYYAKSLGLPVHKLIAAANANSELADFLATG
VYDRNRPFLKTVAPSMDIQISSNLERLLYYKSGEDSAYVAHLMQELETTGRYQVRPDVLT
AIQADFAGGFAVDEEVADAIREVWHRDGYLLDPHTAVGYAVQQQYRAASGDNTPNVLLAT
ASPYKFPRVVAKALQSHVPDDDFAAMQMLQQVSGVPIPPNLARLQQLRPQEKVVVAPTDM
GQAIIGAAKEVFNDDQRVRSGNER
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatacgagcacacgggatcatcaggttagcaaaaccagcaaagaggcaatcaaa
caaggtatttctgaagaaggcggtttgtttgtcctgccgcatttggccgatcagacgctg
aacattcatgaactgttagatttagattatgaaacgattgctcagcgagttctcatgatc
ctgttgcctgattttaacaccgactcactaaaaaaagcgattcattttgcctatcatcag
catttttccgatgatcgcatcacgccagttcgttctgtcggggattttcatgtcttagag
ttatttcatggaccaaccagtgcctttaaggatgtcggcttgcagttgcttccgcgcttg
atgcagttggcacttgatcctgatgatcgggtcatgattttagcggcaaccagcggtgat
acgggaacggcggctctacaagggtttaaagatgtcgcgcagactgggatcacggttttc
tatcctaatcacggtgtcagtccaattcaggagcgccaaatgttgaccgtgggtagtgac
aatacgcgagttttcccaattgctggcaattttgatcaggcccaaagcgcagtgaaaaca
ttgttcactgacactagctttgctgctcggttgcaggcagagcaagtaaccctgtcagca
gccaattccatcaacattggccgactgattccgcaagttgtgtattattttgcagcgtat
agccaactggttaaagcacaggccatttcaatgggagatgaggttaatttcactgttcca
accgggaattttggcgatgtgttggcgggctactatgctaagagtctaggcttgcctgtt
cataaactaatcgcggccgccaatgccaacagcgaattggctgattttctggcaaccggt
gtgtatgatcgcaaccgaccgtttttgaaaacagtggcacctagcatggatattcaaatt
tccagtaatctggaacgcctgttgtattataagagtggcgaagatagcgcgtatgttgcg
catttaatgcaggaacttgagacgactggtcgctatcaagttcggccggatgtgttgacc
gcgattcaagcggactttgctggcggttttgctgttgatgaagaggtggcagatgccatt
cgcgaagtttggcatcgggatgggtatttgctggatccgcacactgctgttggttatgcg
gttcaacagcagtaccgagcggcgtctggggataacaccccgaatgtgcttttagccacc
gcaagcccttataaatttccacgcgtggtggccaaggcactacaatcgcacgtgccggat
gatgactttgctgcgatgcaaatgttgcaacaggttagcggtgtgccgattccgccgaat
cttgctcgccttcaacagctgagaccgcaggaaaaggttgttgtggcaccaaccgatatg
ggccaagctattattggggcggcgaaggaggtattcaacgatgatcagcgtgtccgttcc
ggcaacgagcgctaa

DBGET integrated database retrieval system