KEGG   Lactobacillus casei ATCC 334: LSEI_2336Help
Entry
LSEI_2336         CDS       T00407                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lca  Lactobacillus casei ATCC 334
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LSEI_2336
   01230 Biosynthesis of amino acids
    LSEI_2336
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSEI_2336
  Energy metabolism
   00680 Methane metabolism
    LSEI_2336
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LSEI_2336
Enzymes [BR:lca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LSEI_2336
Exosome [BR:lca04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LSEI_2336
  Exosomal proteins of melanoma cells
   LSEI_2336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2337023..2337694)
Genome map
AA seq 223 aa AA seqDB search
MVKLVLLRHGESIANQKNTYTGWSDVGLTAEGKAQAETAGETIASTGILFDHVHTSVLSR
AIMTAYIVQDKIGQNYLPITKSWRLNERHYGALRGINKDLTRKLFGPDQVASWRRSFSAH
PPLLANPSRTRRYHCYPATIIPRGESLADASQRLLPYWTAELAPRLLSGKNQLIVAHGST
LRALVKFMEDISDAGINKVEIGNAQPIVYTLDDKLTIMDKQTL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtggttaaattagtcctgttaaggcatggcgagagcatcgccaatcagaagaatacttat
accggctggtcggatgtgggtttaaccgcagagggtaaggcacaggctgagacagctggg
gaaacaatcgcgtccacggggatcttgtttgatcatgttcatacgagcgtgctatcgcgg
gcaatcatgacggcatacatcgtgcaagataagatcggccagaactacctgccgatcacg
aaaagttggcggcttaatgagcggcattacggtgccttacgtggtattaacaaggacttg
acgcgcaagctgttcggcccggatcaggttgcaagttggcggcgaagtttttccgcacac
ccgccattacttgctaatcctagtcgaacccggcgttaccactgttatccagccacgatc
atcccgcgcggcgagagccttgccgatgcgagtcaacggttgttaccgtattggacagct
gaactggcaccgcgccttttgtccgggaaaaatcagctcattgtcgctcacggctctact
ttgcgcgccttggtgaagtttatggaagacatcagcgatgctggcatcaacaaggtcgaa
attggaaatgcccaaccgattgtttacaccttggatgacaagctaaccattatggataag
caaactttataa

DBGET integrated database retrieval system