KEGG   Lactobacillus casei ATCC 334: LSEI_2563Help
Entry
LSEI_2563         CDS       T00407                                 

Definition
UDP-N-acetylmuramyl pentapeptide synthase
Orthology
K01929  
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
lca  Lactobacillus casei ATCC 334
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lca00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lca00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2545204..2546592)
Genome map
AA seq 462 aa AA seqDB search
MKMTLAEIARVVKAQPLSEADGSHVVTGLAFDSRKLKPGMLFVPLRGERDGHEFIPAAAT
AGAVATFVAADHLPVTTKLITLVVPDPLKAMQQLAQYYLLMKVNPKVVAITGSNGKTTTK
DMTAAILATQYHVVKTPDNYNNEIGVPMTILSMEPNTEVLVLEMGMDRPGQLHALSTLAE
PDVAVITMIGEAHIEFFKTRDKIADAKMEITDGLKDDGTFIFNGDEPLLQERAKKITQER
ETFGLHPENTIFAHSISGHRNHTEFTVEAWPDLTFSIPIMGEYNVVNALAALLVGRKFHV
KPEIMQKALAHFQVTANRTQWLIGDVGEQILSDVYNANPTAMKAVIHDFSEFTATGRHIA
VLGDMLELGEQSPALHAGLAEALDPKEVQVVYLYGSDMKALADTLAAKYPADQLHYYPLD
DKEQMTRDLQNDVNHDDMVLLKASHGLHLETVLSALVAGGRA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgacattggcagagattgcgcgagttgtgaaagctcaaccgctctctgaagca
gacgggtcgcatgtggtgaccggactggcttttgattcacgcaaattgaagccgggtatg
ctgtttgtgccgttacgcggtgaacgtgatggtcacgaatttattccggcggctgctacg
gctggcgcagtggcaacatttgttgcagcagatcatttacctgtcaccaccaagctgatt
acgctggtggtgccggatccgttgaaagcgatgcaacaattggcacaatattatctgttg
atgaaagtgaatcccaaagtggtggcgatcaccggcagcaatggcaaaacgacaacgaag
gacatgaccgctgcaatcttggccacacaatatcacgtcgttaaaacccctgataactat
aataatgaaatcggcgtgccaatgactattctcagcatggaacccaataccgaagtcttg
gttcttgagatggggatggatcggccagggcaattacatgcactgtcaaccttagctgaa
ccggatgtggccgtgattacgatgatcggggaagcacatattgaatttttcaagacccgg
gataaaattgccgatgccaaaatggaaatcactgatggcctaaaggatgatggtacgttt
atttttaatggtgacgaaccattgttgcaggaacgggcgaagaagatcacgcaggagcgc
gaaacttttggcttgcatcctgaaaatacgatatttgcccattcaatcagcgggcatcgt
aaccacactgagttcacagttgaggcttggcctgatctgacgttctcgattccgattatg
ggtgaatataatgttgtcaatgcgttagcagccctgttagttggccgcaaattccatgtc
aaacccgaaatcatgcaaaaggcattggctcattttcaggtgacggctaaccggacacag
tggttgatcggggatgtaggtgaacagattctaagcgatgtttataacgctaacccgacc
gcgatgaaagccgtcattcatgattttagcgaatttacggcaactggccgtcacattgca
gtgctaggggacatgctggagcttggtgaacaaagtccggcgttgcatgcaggtctggca
gaggcactcgatcctaaggaagtgcaggttgtttatctatacggtagcgatatgaaagca
cttgccgatacattggcagcaaaatatccagccgatcagttgcactattatccgcttgat
gacaaggaacagatgacgcgcgacttacaaaacgatgttaaccatgacgatatggttttg
ttgaaagcgagtcacggattgcatctggaaaccgttttgtcagctttggtcgctggtggt
cgtgcttaa

DBGET integrated database retrieval system