KEGG   Lactobacillus casei ATCC 334: LSEI_2563Help
Entry
LSEI_2563         CDS       T00407                                 

Definition
UDP-N-acetylmuramyl pentapeptide synthase
Orthology
K01929  
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
lca  Lactobacillus casei ATCC 334
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lca00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LSEI_2563
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LSEI_2563
Enzymes [BR:lca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     LSEI_2563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2545204..2546592)
Genome map
AA seq 462 aa AA seqDB search
MKMTLAEIARVVKAQPLSEADGSHVVTGLAFDSRKLKPGMLFVPLRGERDGHEFIPAAAT
AGAVATFVAADHLPVTTKLITLVVPDPLKAMQQLAQYYLLMKVNPKVVAITGSNGKTTTK
DMTAAILATQYHVVKTPDNYNNEIGVPMTILSMEPNTEVLVLEMGMDRPGQLHALSTLAE
PDVAVITMIGEAHIEFFKTRDKIADAKMEITDGLKDDGTFIFNGDEPLLQERAKKITQER
ETFGLHPENTIFAHSISGHRNHTEFTVEAWPDLTFSIPIMGEYNVVNALAALLVGRKFHV
KPEIMQKALAHFQVTANRTQWLIGDVGEQILSDVYNANPTAMKAVIHDFSEFTATGRHIA
VLGDMLELGEQSPALHAGLAEALDPKEVQVVYLYGSDMKALADTLAAKYPADQLHYYPLD
DKEQMTRDLQNDVNHDDMVLLKASHGLHLETVLSALVAGGRA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgacattggcagagattgcgcgagttgtgaaagctcaaccgctctctgaagca
gacgggtcgcatgtggtgaccggactggcttttgattcacgcaaattgaagccgggtatg
ctgtttgtgccgttacgcggtgaacgtgatggtcacgaatttattccggcggctgctacg
gctggcgcagtggcaacatttgttgcagcagatcatttacctgtcaccaccaagctgatt
acgctggtggtgccggatccgttgaaagcgatgcaacaattggcacaatattatctgttg
atgaaagtgaatcccaaagtggtggcgatcaccggcagcaatggcaaaacgacaacgaag
gacatgaccgctgcaatcttggccacacaatatcacgtcgttaaaacccctgataactat
aataatgaaatcggcgtgccaatgactattctcagcatggaacccaataccgaagtcttg
gttcttgagatggggatggatcggccagggcaattacatgcactgtcaaccttagctgaa
ccggatgtggccgtgattacgatgatcggggaagcacatattgaatttttcaagacccgg
gataaaattgccgatgccaaaatggaaatcactgatggcctaaaggatgatggtacgttt
atttttaatggtgacgaaccattgttgcaggaacgggcgaagaagatcacgcaggagcgc
gaaacttttggcttgcatcctgaaaatacgatatttgcccattcaatcagcgggcatcgt
aaccacactgagttcacagttgaggcttggcctgatctgacgttctcgattccgattatg
ggtgaatataatgttgtcaatgcgttagcagccctgttagttggccgcaaattccatgtc
aaacccgaaatcatgcaaaaggcattggctcattttcaggtgacggctaaccggacacag
tggttgatcggggatgtaggtgaacagattctaagcgatgtttataacgctaacccgacc
gcgatgaaagccgtcattcatgattttagcgaatttacggcaactggccgtcacattgca
gtgctaggggacatgctggagcttggtgaacaaagtccggcgttgcatgcaggtctggca
gaggcactcgatcctaaggaagtgcaggttgtttatctatacggtagcgatatgaaagca
cttgccgatacattggcagcaaaatatccagccgatcagttgcactattatccgcttgat
gacaaggaacagatgacgcgcgacttacaaaacgatgttaaccatgacgatatggttttg
ttgaaagcgagtcacggattgcatctggaaaccgttttgtcagctttggtcgctggtggt
cgtgcttaa

DBGET integrated database retrieval system