KEGG   Lactobacillus casei ATCC 334: LSEI_2675Help
Entry
LSEI_2675         CDS       T00407                                 

Definition
ribose-5-phosphate isomerase A (EC:5.3.1.6)
Orthology
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
lca  Lactobacillus casei ATCC 334
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:lca01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lca01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:lca00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2661092..2661781)
Genome map
AA seq 229 aa AA seqDB search
MDQNKLKQEAAQRAAEFVEDGMTIGLGTGSTVVYLVEAIAQRIKDEHLNLTGVATSVRTR
KQAESLGIPMKALDEVGQIDLTIDGADEVDKHFQGIKGGGRSHLIEKIVAINSARNIWIV
DETKLVDTLGKFPLPLEVIPFGSGKLLQRLADEGLKPAYRLNEDGSKALTDSKNYIIDLH
LGKIEHPHLLAEWLNKQVGIVEHGLFLDLVKTVVVGTTHGPEILDAHRG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggaccagaataagttgaagcaggaagccgcgcaaagagcagctgagtttgttgaagac
ggtatgacaattggtttggggacaggttcgacagtggtttatttggtcgaagcgattgcg
caacgaatcaaagacgagcatctcaatctaaccggtgtcgccaccagtgttcgtacgcgc
aaacaagcagaatcgctgggcatcccaatgaaagcactggacgaggttggccagattgat
ttgacgattgatggtgccgatgaagtcgacaagcactttcagggcatcaagggtggcggc
cggtcgcacttaatcgaaaagatcgttgctatcaactcggcccgcaacatctggatcgtg
gatgaaaccaagttggtcgatacccttggcaaatttccactgccgcttgaagtgatccct
tttggcagcggcaagctgttgcaacggttggccgacgaaggacttaaaccggcataccgc
ttaaatgaagatgggagcaaggcgttgacagattccaagaactatatcattgacttgcat
ctgggcaaaatcgagcacccgcatctgctggctgaatggctgaataagcaggtcggtatt
gtggagcatggcttgttcttagatttggtcaaaaccgtggtcgttggcacaacacatggc
ccagagattctggacgcacatcgtggatag

DBGET integrated database retrieval system