KEGG   Lactobacillus casei ATCC 334: LSEI_2703Help
Entry
LSEI_2703         CDS       T00407                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lca  Lactobacillus casei ATCC 334
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LSEI_2703
   01230 Biosynthesis of amino acids
    LSEI_2703
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSEI_2703
   00051 Fructose and mannose metabolism
    LSEI_2703
   00562 Inositol phosphate metabolism
    LSEI_2703
Enzymes [BR:lca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LSEI_2703
Exosome [BR:lca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LSEI_2703
  Exosomal proteins of bladder cancer cells
   LSEI_2703
  Exosomal proteins of melanoma cells
   LSEI_2703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2689888..2690580)
Genome map
AA seq 230 aa AA seqDB search
MASVKKPFFIVNPKSYLYGDDAVKLAKIADEIAAEKHLDCLFTGQLIDLPRIKAATSHLI
ITAQHMDPLLPGRGMGHVLPEALKAADVEAVVLNHAENPLEIGVLDKTITRAKAVGLMTV
VCSDTPSESRAIASLHPTMMICEPTNLIGTGSISNDDYIKATNDAVRSVDPDILIMQAAG
VSTGADVKKVLALGADGTGGTSGIINARDWRAKLMEMMGAMAAYKEAQLA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtgttaagaaaccttttttcattgtgaatcctaagtcgtatctttatggtgat
gatgccgtgaagctggcaaaaattgcggatgagattgctgccgaaaagcatcttgactgt
ttatttacggggcaactgattgatctgccacggatcaaggcggcaacgagccacttgatc
atcacggcacagcacatggacccgctgcttcccggccgtggcatgggccatgttttacct
gaagccctgaaagctgcggatgttgaagcggttgtgctgaatcatgctgaaaatccgctg
gaaatcggtgttttggataagacgattacccgtgctaaagcggtcggcttaatgacagtt
gtctgttccgatacgccttctgaaagtcgcgcgattgcgagtctgcacccaaccatgatg
atttgcgaaccaaccaatttaattgggaccggaagtatcagcaatgatgactatattaaa
gcgaccaatgatgccgttcgcagtgtcgatcctgatattttgatcatgcaagcagctggt
gtcagcactggcgcagatgtcaagaaggtattggcattgggcgctgatggaactggcggc
acaagcggtattattaatgcccgtgattggcgggcaaaattgatggaaatgatgggtgca
atggcagcatacaaggaggcacagttagcatga

DBGET integrated database retrieval system