KEGG   Lactobacillus casei BL23: LCABL_00720Help
Entry
LCABL_00720       CDS       T00723                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lcb  Lactobacillus casei BL23
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lcb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LCABL_00720 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCABL_00720 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LCABL_00720 (trpA)
Enzymes [BR:lcb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LCABL_00720 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(71561..72355)
Genome map
AA seq 264 aa AA seqDB search
MSKLADVFKNHKVFIPFIVADDPDFETTVKNVVALAKGGADIVELGIPFSDPVADGPVIQ
AADLRAFAANVRTKTVFDIVEAARKETAVPIVFLTYLNIVFKYGYEAFLKRCADLNVAGL
VIPDLPYESRDEIVPIAEKYGIDIIPLITPTSGHRIEKIAKSASGFIYVVSSMGITGERD
EFFAGLKALVAEIKQYTNVPTAIGFGIHTPEQAQTMAGIADGVIIGSAIVDLVAKEKQQA
PAAIEKFTKQIRVSVDAKKQISVK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagttagcagatgtttttaaaaatcataaagtctttatccccttcatcgtcgct
gatgatcccgattttgaaaccaccgtcaaaaacgtggtcgcacttgccaaaggtggcgcc
gatattgtggagttaggcatccctttttccgatccagtcgccgacggtcccgtgattcaa
gccgccgacctaagagcattcgccgccaacgttcgcaccaaaacggtctttgacattgtg
gaggctgcccgcaaagaaaccgcggtgccaatcgtcttcctaacttacttgaacattgtc
ttcaaatacggctacgaagccttcttaaaacgctgtgcggatttaaatgtcgccggcttg
gtgattccagatctgccatatgaaagtcgcgatgaaattgtgccaattgccgaaaaatac
ggtatcgatattattccgttaatcacgccaacttccggtcatcgaattgaaaaaatcgcc
aaaagtgcctcaggatttatctatgtcgtttcctcaatgggcattactggcgaacgcgat
gaattctttgctggcttaaaggcattagtcgcagaaattaagcagtataccaacgttcca
accgctatcggtttcggcattcacacgcctgaacaagcacaaacaatggcaggcatcgcc
gatggtgtcatcatcggcagcgccatcgttgatcttgtcgcgaaggaaaaacaacaggca
ccggctgcgattgaaaagtttactaagcagatccgagtgtccgttgatgctaaaaagcaa
atttcggtgaaataa

DBGET integrated database retrieval system