KEGG   Lactobacillus casei BL23: LCABL_00730Help
Entry
LCABL_00730       CDS       T00723                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lcb  Lactobacillus casei BL23
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lcb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LCABL_00730 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCABL_00730 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LCABL_00730 (trpB)
Enzymes [BR:lcb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LCABL_00730 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(72348..73568)
Genome map
AA seq 406 aa AA seqDB search
MKTLNETTQQSTRAGRYGKDFGGQYIPETLMTELEKVTKAFNDLKDNPEFKAELNDLLVN
YANRPSLLYYAKNMTEDLGGAKIYLKREDLNHTGAHKINNVIGQALLAKHLGKKRLIAET
GAGQHGVATATIAALMGMDCEIFMGKEDTDRQKLNVYRMELLGAKVHPVTSGSMVLKDAV
NATLQEWASRSDDTFYVLGSAVGPAPFPEMVKHFQSVISTESKQQLQAKETRLPDMVVAC
VGGGSNAIGSFAAYIDDPSVQLVGVEAAGKGVDTDRTAATIERGSVGIFHGMKSLFMQNE
DGQIDPVYSISAGLDYPGVGPEHAALAQEGRAQYVGITDDEAVEAFTYIAKQEGIVAAIE
SCHAIAYVEKIAPQMAKDQIIICTLSGRGDKDVASIAKYKGVDVDE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaagacattaaatgaaacaacccaacagtcaacacgcgccggtcgttatggaaaagac
tttggcggccagtatattcctgaaaccctcatgaccgagcttgaaaaagtaactaaggct
ttcaatgacttaaaagataatcctgaatttaaagcagaattaaatgatctattggttaat
tacgccaatcgcccctcgttgctttattatgccaagaacatgaccgaagaccttggtggc
gccaaaatctacttaaaacgggaagatttaaatcataccggtgcacataagatcaataat
gtcatcggtcaggccttgcttgccaaacatttaggcaaaaagcgcctgattgccgaaacc
ggcgccggtcaacatggtgtcgctaccgccaccattgccgcactcatggggatggactgt
gaaattttcatgggtaaagaagacactgaccgtcaaaagttaaacgtttatcgcatggaa
cttctcggcgcaaaggttcatccagtcacaagcggatcaatggttttaaaagacgcggtt
aacgccacactgcaagaatgggcgagtcgcagtgatgacactttctacgtgttaggttct
gcagtcggccctgcgccgttccccgaaatggtgaaacattttcaaagtgttatttcaacg
gaatcgaaacagcaacttcaggccaaagaaactcggctgccagacatggtcgttgcctgt
gtaggtggtggcagtaacgccattggaagttttgctgcttacattgatgatccttctgtt
caattagtcggcgttgaagcagccggtaaaggcgttgataccgacagaaccgccgcaact
atcgaacgcggctccgttggcattttccacggcatgaagtccttattcatgcaaaatgaa
gatggccagattgatccggtctattccatttctgctggccttgattaccccggcgttggt
cccgagcatgccgctctcgctcaggaaggccgggcgcaatacgttggcattaccgacgac
gaagcagttgaagcctttacctacattgcgaaacaagaaggcattgttgccgccattgaa
agctgtcacgccatcgcctacgttgaaaagattgccccacagatggcaaaagatcaaatc
attatctgtaccttgtccggacgtggcgataaggacgtcgcaagcattgccaaatacaaa
ggagtcgatgttgatgagtaa

DBGET integrated database retrieval system