KEGG   Lactobacillus casei BL23: LCABL_00730Help
Entry
LCABL_00730       CDS       T00723                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lcb  Lactobacillus casei BL23
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lcb01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lcb00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lcb00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(72348..73568)
Genome map
AA seq 406 aa AA seqDB search
MKTLNETTQQSTRAGRYGKDFGGQYIPETLMTELEKVTKAFNDLKDNPEFKAELNDLLVN
YANRPSLLYYAKNMTEDLGGAKIYLKREDLNHTGAHKINNVIGQALLAKHLGKKRLIAET
GAGQHGVATATIAALMGMDCEIFMGKEDTDRQKLNVYRMELLGAKVHPVTSGSMVLKDAV
NATLQEWASRSDDTFYVLGSAVGPAPFPEMVKHFQSVISTESKQQLQAKETRLPDMVVAC
VGGGSNAIGSFAAYIDDPSVQLVGVEAAGKGVDTDRTAATIERGSVGIFHGMKSLFMQNE
DGQIDPVYSISAGLDYPGVGPEHAALAQEGRAQYVGITDDEAVEAFTYIAKQEGIVAAIE
SCHAIAYVEKIAPQMAKDQIIICTLSGRGDKDVASIAKYKGVDVDE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaagacattaaatgaaacaacccaacagtcaacacgcgccggtcgttatggaaaagac
tttggcggccagtatattcctgaaaccctcatgaccgagcttgaaaaagtaactaaggct
ttcaatgacttaaaagataatcctgaatttaaagcagaattaaatgatctattggttaat
tacgccaatcgcccctcgttgctttattatgccaagaacatgaccgaagaccttggtggc
gccaaaatctacttaaaacgggaagatttaaatcataccggtgcacataagatcaataat
gtcatcggtcaggccttgcttgccaaacatttaggcaaaaagcgcctgattgccgaaacc
ggcgccggtcaacatggtgtcgctaccgccaccattgccgcactcatggggatggactgt
gaaattttcatgggtaaagaagacactgaccgtcaaaagttaaacgtttatcgcatggaa
cttctcggcgcaaaggttcatccagtcacaagcggatcaatggttttaaaagacgcggtt
aacgccacactgcaagaatgggcgagtcgcagtgatgacactttctacgtgttaggttct
gcagtcggccctgcgccgttccccgaaatggtgaaacattttcaaagtgttatttcaacg
gaatcgaaacagcaacttcaggccaaagaaactcggctgccagacatggtcgttgcctgt
gtaggtggtggcagtaacgccattggaagttttgctgcttacattgatgatccttctgtt
caattagtcggcgttgaagcagccggtaaaggcgttgataccgacagaaccgccgcaact
atcgaacgcggctccgttggcattttccacggcatgaagtccttattcatgcaaaatgaa
gatggccagattgatccggtctattccatttctgctggccttgattaccccggcgttggt
cccgagcatgccgctctcgctcaggaaggccgggcgcaatacgttggcattaccgacgac
gaagcagttgaagcctttacctacattgcgaaacaagaaggcattgttgccgccattgaa
agctgtcacgccatcgcctacgttgaaaagattgccccacagatggcaaaagatcaaatc
attatctgtaccttgtccggacgtggcgataaggacgtcgcaagcattgccaaatacaaa
ggagtcgatgttgatgagtaa

DBGET integrated database retrieval system