KEGG   Lactobacillus casei BL23: LCABL_00750Help
Entry
LCABL_00750       CDS       T00723                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase (IGPS)
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lcb  Lactobacillus casei BL23
Pathway
lcb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lcb01100  Metabolic pathways
lcb01110  Biosynthesis of secondary metabolites
lcb01130  Biosynthesis of antibiotics
lcb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lcb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LCABL_00750 (trpC)
Enzymes [BR:lcb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LCABL_00750 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh His_biosynth QRPTase_C PDZ IMPDH DHO_dh ComA PEP_mutase ThiG
Motif
Other DBs
NCBI-ProteinID: CAQ65207
UniProt: B3W6W8
Position
complement(74179..74961)
Genome map
AA seq 260 aa AA seqDB search
MILDDLVTVTKIRLARHQRQQSLADLKQTVAKMPRNHKPDFLTRLKQPGLHVIAEVKKAS
PSKGTIVTDFPYLAIAKAYDQAGADAISVLTEPDYFNGHLHYLKEISQQVSVPTLRKDFT
IDPYMIYEAKANGAVIILLIVAILTDQQLRDYRQLAEKLGMHAIVEAYTAAEVTRALQSG
AKIIGINNRNLKDFRVDFNNSLKLRAMVPDNIPVVAESGIKTQEDVEKLAAAGFNAILIG
ETLMRSNQKRQLIAAFKERA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgatcttagacgatttggtgactgtgaccaaaattcgtttagcgcgtcaccaacgccaa
cagtcacttgctgatttaaaacaaaccgtggccaaaatgccgcgcaatcacaagccggat
tttctaacacgcttaaaacaacctggcctacacgtgatcgctgaggtcaaaaaggcctcg
ccatcaaaggggacaattgtcacagattttccctacttggcgatcgccaaagcgtacgat
caagccggtgccgatgctatctcggtcttgaccgaacccgattatttcaacggccacctt
cattatctaaaggaaatcagccaacaagtgtcggtgccaacgcttcgaaaagattttacg
attgatccttatatgatctacgaggctaaggcaaacggggctgtcattattttactgatt
gttgcgatcctaaccgatcagcaattgcgcgattatcgccaactggctgaaaaactcggt
atgcacgcaattgtcgaggcctatacagccgctgaggtcacacgggcactacagtcaggt
gcaaagataatcggcattaacaaccggaatctcaaagactttcgagttgatttcaacaat
agtttgaaattaagagccatggtgcccgacaacatccccgtcgttgcggaaagcggcatt
aagacgcaggaagacgttgaaaaactggcagcagctggcttcaatgccattctcatcggt
gaaacactcatgcgatctaaccaaaagagacaattaattgcagcatttaaagaaagagcg
tga

DBGET integrated database retrieval system