KEGG   Lactobacillus casei BL23: LCABL_01680Help
Entry
LCABL_01680       CDS       T00723                                 

Gene name
xpk
Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
lcb  Lactobacillus casei BL23
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LCABL_01680 (xpk)
Enzymes [BR:lcb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     LCABL_01680 (xpk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
169650..172031
Genome map
AA seq 793 aa AA seqDB search
MDTKVKTVDYSSKEYFDKMTAYWRAANYISVGQLYLKDNPLLERPLKSEDVKPHPIGHWG
TIAGQNFIYTHLNRVINKYDLNMFYIEGPGHGGQVMVSNSYLDGSYSEIYPRVSQDKEGM
KNLFTQFSWPGGVASHASAQTPGSIHEGGELGYALSHATGAILDNPEVIAAVVTGDGETE
TGPLAASWFSNTFINPITDGAILPIVHMNGFKISNPTILSRKSDEDLDKYFSGMGWKPFF
VEGDDPEKLNPEMAKVLDEAIEDIKAIQKHARETGDTTMPHWPVIIFRSPKGWTGPKSWN
GEPIEGSFRAHQIPIPVDAEDMEHADSLAGWLKSYHPEELFDENGKLIPELAALPPKGEQ
RMAANPITNGGIDPKPLVLPDYRKYALDNKEHGKQIKQDMIVWSDYLRDLIKLNPHNFRI
FGPDETMSNRLYSLFEVTNRQWLEPIKEPADQYLAPAGRIIDSQLSEHQAEGFNEGYTLT
GRHGLFTSYEAFLRVVDSMLTQHFKWIRKAHEEPWHKAYPSLNVVSTSTSFQQDHNGYTH
QDPGILTHMAEKKAEYIREYLPADANSLLAISPKLFSSQNTVNVLITSKQPRPQFYSIDE
ATVLANSGLKRIDWASNDDGVEPDVVIAAAGTEPNMESLAAINLLHDAFPDLKIRFINVV
DLLKLRSPEIDPRGLSDAEFNSYFTTDKPILFAYHGFEGLIRDIFFTRPNRNVLIHGYRE
EGDITTPFDMRVLNELDRYHLAKDVIQHVPAYAEKAAAFVQKMDDTLQYHHDFIRANGDD
IPEVQEWTWKPIK
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaaagtaaagactgttgattactcatccaaggaatactttgacaagatgacc
gcttattggcgggcagccaactatatttcagttggtcaactttatttgaaggacaacccg
ctgctggaacggccactgaagagcgaagacgtcaagccgcatccgatcggccattggggc
acgattgctgggcagaacttcatttatacccacttgaaccgggtgatcaataagtatgac
ttgaacatgttttatattgaaggcccgggtcatggcggccaagtgatggtttccaattcc
tatctagacggttcgtattcggagatttatccgcgtgtgtcgcaggataaagaaggcatg
aagaacctatttacgcagttctcatggccaggtggcgttgcttcacatgcgagtgcacaa
acgccaggttccatccatgaaggtggcgaattaggttatgctttgagtcacgcaaccggc
gcgattcttgataatcctgaggtcatcgcggcggttgtcacgggtgatggtgaaactgaa
accggcccattggctgcatcatggttcagcaatacgttcattaacccaatcacggatggc
gcgattttaccgattgtgcatatgaacgggtttaagatttccaacccaactatcttgtca
cgtaagtcagatgaagatctagacaaatacttcagtggtatgggttggaagccattcttc
gttgaaggcgatgatccagagaagctgaatccggaaatggctaaagttttggatgaagca
attgaagacattaaggccattcagaaacatgcacgtgagactggcgacaccacgatgcca
cactggccagtgattattttccggtcaccaaagggctggacaggcccgaagagttggaat
ggcgaaccaatcgaaggttccttccgtgcgcaccagattccgattcctgtcgacgctgaa
gacatggaacacgctgattccttggcaggctggctgaagtcctaccatccagaggaactg
ttcgatgaaaacggcaagttgatccctgaattggctgcattgccgccaaagggtgagcag
cggatggctgctaacccaattacgaacggtgggattgatccgaagccgttggtattgcca
gattatcgcaagtatgcgctggacaacaaggaacacggcaagcagattaagcaagacatg
atcgtgtggtctgattatctgcgtgatttgatcaagctgaatccgcataatttccggatc
tttggccctgacgaaaccatgagtaaccggttgtatagcttgtttgaagtgaccaaccgt
caatggctggaaccaatcaaggaaccggctgaccaatatttggcaccggctggtcggatt
attgactcgcagttgtccgaacatcaggcggaaggctttaacgaaggctacacgttgacc
ggccgtcatggcttattcaccagttacgaagctttcctccgggtcgtcgattccatgctt
acgcagcacttcaagtggattcggaaggcacatgaagaaccatggcataaggcttatcca
agtctgaacgtggtctcaacatcgacttccttccagcaggatcacaatggttacacccat
caggacccaggtattttgacacacatggctgaaaagaaggctgaatacattcgcgagtat
ctaccagctgatgccaacagcttgctggccatttctccgaagttgttcagctcacaaaat
accgtgaacgtgctcatcacatccaagcagccgcggccacagttctatagcattgatgaa
gccactgttttggctaattccggcttgaagcggattgattgggcttccaatgatgatggc
gtcgaaccagatgttgtcattgccgctgccggaaccgaaccaaacatggaaagtcttgct
gccattaacttgctgcacgacgccttcccagatttgaagattcgcttcattaacgtggtt
gacctgctgaagctgcgcagtccggaaatcgatccgcgcggtttgagtgatgctgaattc
aacagctacttcaccaccgacaaaccgatcctcttcgcttatcatggctttgaagggttg
attcgcgacatcttcttcactcgcccgaatcgcaatgtgctgattcacggctatcgtgaa
gaaggtgacattaccacaccatttgacatgcgggtactcaacgaacttgaccgttaccac
ttggccaaggatgttattcagcatgtgccagcctacgctgaaaaggctgccgcgtttgtt
cagaagatggatgataccttgcaatatcatcatgacttcatccgcgcaaacggcgatgat
attccagaagttcaggaatggacctggaaaccaattaagtaa

DBGET integrated database retrieval system