KEGG   Lactobacillus casei BL23: LCABL_11320Help
Entry
LCABL_11320       CDS       T00723                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lcb  Lactobacillus casei BL23
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCABL_11320 (tpiA)
   01230 Biosynthesis of amino acids
    LCABL_11320 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCABL_11320 (tpiA)
   00051 Fructose and mannose metabolism
    LCABL_11320 (tpiA)
   00562 Inositol phosphate metabolism
    LCABL_11320 (tpiA)
Enzymes [BR:lcb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LCABL_11320 (tpiA)
Exosome [BR:lcb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LCABL_11320 (tpiA)
  Exosomal proteins of bladder cancer cells
   LCABL_11320 (tpiA)
  Exosomal proteins of melanoma cells
   LCABL_11320 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1082504..1083259
Genome map
AA seq 251 aa AA seqDB search
MRTPFIAGNWKMNKNPKETQEFLDGVKGKLPDASKVETVIGAPAIDLTTLVAGAEGTPLK
TAAENCYFEDEGAFTGETSPKALKEMNVDYVIIGHSERRGYFHETDEDINKKAKAIFKNN
LLPIICCGESLAQREAGQTEDWVASQIEAALAGLSADQVKVSVLAYEPIWAIGTGKTATA
DQAQEVVAHIRATVEKLYNKDTADAVRILYGGSVKPANVKELMAKPDIDGGLVGGASMDP
ESFIALANYQD
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacaccattcattgctggtaactggaaaatgaacaaaaatcctaaggaaacgcaa
gaattcttagacggcgttaaaggcaagttgcctgatgcaagcaaggttgagactgtcatt
ggtgcacctgccattgatttgaccaccttagttgctggcgctgaaggcacacctttgaag
acggcggctgaaaactgctactttgaagacgaaggtgccttcactggtgaaaccagcccg
aaagctttgaaagaaatgaacgttgattacgtcattatcggtcacagcgaacgtcgcggc
tatttccacgaaaccgatgaagatatcaataagaaggctaaggccatctttaagaacaat
cttttgccaatcatttgctgtggcgaaagtttggctcagcgcgaagctggccaaaccgaa
gactgggttgcttcacagattgaagctgctttggccggtttaagtgctgaccaagtcaaa
gtttcagtcttagcctatgaaccaatctgggctatcgggacaggtaagacggcaactgcc
gatcaggcacaagaagttgtcgcacatattcgtgcaacggttgagaagttgtataataaa
gatacggcagatgctgttcgtattctttacggcggctctgttaaaccagcgaacgtcaag
gaattaatggctaagcctgatatcgatggcggcttagtcggtggcgcttcgatggatcct
gaaagtttcatcgccttggctaactaccaagattaa

DBGET integrated database retrieval system