KEGG   Lactobacillus casei BL23: LCABL_11380Help
Entry
LCABL_11380       CDS       T00723                                 

Gene name
estA
Definition
esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lcb  Lactobacillus casei BL23
Brite
Enzymes [BR:lcb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     LCABL_11380 (estA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1088891..1089625
Genome map
AA seq 244 aa AA seqDB search
MIFREPQPFEYEGTDTGVVLLHAYTGSPNDMNFMGRALQRAGYGVYAPLFTGHGTIEPMD
ILTKGNPDIWWAEASAAVSHMTAKYDRVFVFGLSLGGIFAMKALEILPGVTAGGVFSSPI
LPGKHHLVPGFLKYAQYMNRLAGVPDESTQILAYLPGQLAAIDNFATGVAADLYLVNKPI
FIGQAGADELVDGQLAYQLRDALINAPQVDFHWYDNAKHVITVNSAHHALQQDVVAFMQQ
ENEG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgatctttcgtgaaccgcaaccattcgaatacgagggcactgataccggtgttgttttg
ctgcatgcctatactggcagcccaaacgacatgaacttcatggggcgggccttgcagcgg
gctgggtatggcgtgtatgcgccgttgttcacgggacatggtaccattgagccaatggat
attctgactaagggcaacccagatatttggtgggcagaggccagcgcggctgtttcgcat
atgacagcaaagtatgaccgtgtttttgttttcggattatcactcggcggtattttcgcc
atgaaagctttggaaatattacccggtgtcacagctggcggcgttttttcatcgccgatc
ttaccgggtaagcaccatctcgtgccagggtttctgaaatacgcacaatatatgaatcgt
ttggcaggtgtaccagacgaaagtactcagattttggcttacttaccaggccagctggcg
gcgattgacaatttcgccactggggttgccgctgatctgtatttagttaataagccgatt
tttatcggccaagccggtgctgatgaattagttgatgggcagctggcctatcagctacgg
gatgcactcatcaatgcaccgcaagtagattttcattggtatgacaatgccaagcatgtg
atcaccgtgaattcggcgcatcacgcactacaacaagacgttgtcgcatttatgcaacaa
gaaaacgagggatag

DBGET integrated database retrieval system