KEGG   Lactobacillus casei BL23: LCABL_12010Help
Entry
LCABL_12010       CDS       T00723                                 

Gene name
gala
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lcb  Lactobacillus casei BL23
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:lcb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LCABL_12010 (gala)
  Lipid metabolism
   00561 Glycerolipid metabolism
    LCABL_12010 (gala)
   00600 Sphingolipid metabolism
    LCABL_12010 (gala)
Enzymes [BR:lcb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LCABL_12010 (gala)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1157102..1159393
Genome map
AA seq 763 aa AA seqDB search
MIDVINNQAFHLHNDQISYICALLPNGQLGHLYFGPRLSLTKNDLAYLSQGPSPFAWMAN
FSDDQEFALGDAQQEYPVYGTGDFRQGSLSVTQDDMPIYPNFVFKDDQLTHTKTRDLHHP
TSFGNPALTDVLTIHLEDKTAQLLLTLQYTIFADSAAIVRSATLTNQGTAPVMIQRMLSG
VLNLPQGRYDVVHLSGNWAKERHIQTQPLTQGTFSVESLRGASSHEQNPFVALHAAGQPF
AAGDTYGANLIYSGNFLDSTEVNEWDQTRLLTGIHPASFSWRLDPKTSFTTPETVFSYSS
GGLAGLAQANQRFVARHIIDPQWRQKQRPVVLNSWEATYFDLNEKKLLKLAALGKQVGVD
CFVLDDGWFGTRDNDLSSLGDWFTNKHKFPDGLGHFAQEIHAMGLQLGLWFEPEMVSPRS
QFFQAHPNWVVRPKKGRISITCNQYVLDFSNPAVVNNIFEQMQKVITETNLDYVKWDLNR
SITEAFSPYLEKIGHPQGEFFHRYVQGVYTLYQKLLTAFPHLLIEGCAGGGGRFDLGILF
YSPQIWTSDDSDAIERLAIQSGTALAYPLSCMSNHVTAVPNEQVGRSTPLVTRFRVAAFG
ILGYELDLTKLDARTLATIKAQIAYYHALQPLVLKGDFSLLLPRQSNGQNQVAWLLSAHD
RKHLVLGFFRVLADADSRTVQYMKVPLAKSDTPYWVNQHTGPISGDVLQRVGVRLPVQFN
GANRAQAQLIGDYQSALLTFDSVASLDHSESQQTDADKQTVAH
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
ttgatagatgttataaataatcaagcttttcatcttcacaacgatcaaatcagttatatt
tgcgctttgctgccgaatggtcagctcgggcatctttattttggtccgcgcttgtcatta
actaaaaacgacttagcctatttgtctcaaggcccaagtccgtttgcgtggatggccaat
ttttcagacgaccaggaatttgccttgggtgatgcgcagcaagagtatcctgtttacggc
actggtgattttcgccaaggcagcctgagtgtgacccaagatgatatgccaatttatccg
aactttgtttttaaagatgatcaattgacgcatacgaaaacgcgggacttgcaccatccg
acgagtttcggcaatccggcattgaccgatgtgctgacgattcatcttgaagataaaacg
gcccaattgttgctaacgttgcaatatacgatttttgccgacagtgcggcaattgttcgt
tccgccacactaaccaatcaagggacagcaccagtgatgattcaacgcatgctgagtggc
gttttgaacttgccgcaaggacggtatgacgttgttcatttatctggtaattgggcgaag
gagcgtcatattcaaacgcaaccgttaacccagggaactttttcagttgaatcgctacgt
ggtgcctccagtcatgaacaaaatccttttgtggccttacatgcagcgggacagccgttt
gcagcaggggatacctatggggcgaacttgatttattcgggcaactttctggacagcacc
gaggtcaacgaatgggatcagactcgattgctaactggcattcatcccgcatcgtttagt
tggcggttggatccaaaaaccagttttaccacgccagaaaccgtgtttagttatagctct
ggtggtcttgccggcttagctcaggccaatcaacgttttgttgctcgccatattattgat
ccgcaatggcgtcaaaagcagcgtccggtcgtcttaaacagctgggaagcgacttacttt
gatttgaatgagaagaagttgctcaagctagcggcactcggcaagcaggtcggtgtggac
tgctttgtgctggatgatggttggtttgggacgcgcgacaatgatttgagttccttgggt
gattggtttactaataagcataaatttcccgacggtctcggccattttgctcaggaaatt
catgcgatgggcctgcagcttggcctttggtttgaacccgagatggtttcaccgcgatct
caattcttccaagcccatccgaattgggtcgttcgaccaaaaaagggtcgtatctcgatc
acgtgtaatcaatatgtgttagacttcagcaacccggctgtcgtcaacaatatttttgaa
cagatgcaaaaggtcatcactgaaaccaacttggattatgtgaagtgggatcttaatcgc
agcattacagaggccttttcaccgtatctcgaaaagatcggtcatccgcaaggcgagttc
ttccatcgttatgtacaaggcgtgtacacgctctatcagaagctgctaacagcattcccg
catttattgattgaagggtgtgccggcggtggtggccgctttgatctgggcattctgttc
tacagcccgcaaatttggactagtgatgattccgatgcgatcgaacgcctcgccattcaa
tcaggcacggctttggcctatccattgagctgtatgagcaatcatgtgacggccgtgccg
aatgaacaggttggtcgatcaacgccgctggtcacgcggtttcgggtggcggcctttggg
attcttggttatgaactggatctgaccaaacttgatgcgcgaacattggctacgatcaag
gctcaaattgcctattaccacgccttacaaccgctagtactgaaaggcgactttagccta
ttgttaccgcgacagtccaatgggcagaatcaggtggcgtggttgctcagcgctcatgat
cgcaagcaccttgttcttggctttttccgagtcttggctgatgcagacagtcgcaccgtg
cagtatatgaaggtgccattggcaaaatctgacacaccgtattgggtcaatcagcacaca
ggcccaatttcgggggatgtcctccagcgcgttggtgtgcgcttaccagtccaattcaat
ggcgccaatcgcgcacaggctcagttaatcggtgactatcaatcggcactgttgaccttt
gatagtgtggcaagtttggatcacagtgaaagccagcagaccgatgccgacaagcaaaca
gttgcccattaa

DBGET integrated database retrieval system