KEGG   Lactobacillus casei BL23: LCABL_12170Help
Entry
LCABL_12170       CDS       T00723                                 

Definition
lysophospholipase L1 related esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
lcb  Lactobacillus casei BL23
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:lcb00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LCABL_12170
Enzymes [BR:lcb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     LCABL_12170
   3.1.2  Thioester hydrolases
    3.1.2.-  
     LCABL_12170
Lipid biosynthesis proteins [BR:lcb01004]
 Fatty acid synthase
  Component type
   LCABL_12170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1169075..1169866)
Genome map
AA seq 263 aa AA seqDB search
MKKFWLGFGLLLLILAAGCEVQHKAAKSSSSAASLRSRKSPSSRSSAAIKQTSMLARLKA
KSQTTLVYAPFGDSLSVGLFADSKTSRFTTLFADQLHHLTDKTVTEEGIAEVGKTATNLG
VPALPALIAQHPDLITIEFGTNDAVGGATPTALADYRQALTTIVATLQKQTTAELILMTT
WSPNHGPYAAADLQFDAVVKQIGQTYHVPVADLATIWQNHDDVTGPAGTAITDFAGNGPR
DTFHPNQRGHDQIAALLKKTLEE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttttggttgggttttggtcttttattgctcattttagcggctggctgcgag
gttcaacacaaggcggctaaatcgagcagttcagcggcttcgcttcgcagccgcaagtcg
cctagttcgcgatcctcagctgcgattaagcagacaagcatgctcgcccggctgaaggca
aaatcacaaacgacgctcgtgtatgcaccgtttggcgacagcctctctgttggtttgttt
gcggatagtaaaacaagccggtttaccaccctttttgctgaccaattacaccatttgact
gacaagacggtgacagaggaagggattgcagaggtgggaaaaaccgcgactaatcttggt
gtccctgctctgccagcgttgattgcccagcatcctgatttgattaccatcgagtttggg
acgaacgatgcggttggcggcgccacaccaacggcgctggctgattaccgccaggcgttg
acaaccatcgtggcaaccttgcagaagcaaacaacagctgagttgatccttatgacgacc
tggtcgccaaaccatggtccttatgccgccgccgatttgcaatttgatgctgtggtcaaa
caaatcggtcaaacttatcacgttccagttgccgatctggcgaccatctggcaaaaccat
gatgacgtcacaggccctgccggtacagccatcaccgacttcgctggtaacggtccgcgc
gatacttttcaccccaaccagcgcggtcatgatcagattgctgccttgctcaagaaaact
ttggaggaataa

DBGET integrated database retrieval system