KEGG   Lactobacillus casei BL23: LCABL_13750Help
Entry
LCABL_13750       CDS       T00723                                 

Gene name
murC
Definition
UDP-N-acetylmuramyl tripeptide synthase ()
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lcb  Lactobacillus casei BL23
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lcb00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LCABL_13750 (murC)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LCABL_13750 (murC)
Enzymes [BR:lcb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     LCABL_13750 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1313253..1314605)
Genome map
AA seq 450 aa AA seqDB search
MAFSAKASLATAIGRSSYWFLHTFLKGGSSLPGQIANRIDPQVLRTLGQNYDVIVVTGTN
GKTLTTSLIVKVLKKKYKEVLTNPTGSNMLQGITTAFLAQPKRGHGRGIAVLEVDEANVA
PVAAQLKPKAFVLTNIFRDQMDRYGEFYTTYQKILDGVTRDPEAMVIANGDAPIFSSRKL
PNPVTYYGFELTANGDHKAPPNTDGVLCPVCQHILHYHAQTYANLGNYFCPHCGFKRPAL
THQITEVTQMTPQSSDFMIDDQPCHIDIGGMYNIYNALAAFAVGRAFGVTPTEISQAFAY
DEKVFGRQEVIQLGKKKLTLILVKNPVGLNQVLSMIETAKQPFGFAMLLNANYADGIDTS
WIWDGNFEELVASQKAASYLVGGERYKDIGLRLTVAGVPEKALVSKPALDDVISTLKRSP
QDQLYVLATYTAMLQLRKKLSDGGYIKAGF
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtggcattttctgcaaaagctagcctggcaactgccattggtcgcagcagttactggttc
ttacacacatttctaaaaggcgggtcgagcctaccaggccagatcgccaaccgaattgat
ccccaagtcttgcggacgctcggtcaaaactacgatgttattgtggtgactggaacaaat
ggcaagacgttgaccaccagcctgattgttaaggtgcttaagaaaaaatataaagaagtc
ttaacgaaccccactggctccaacatgttgcaaggtatcacaacggcttttttggcccag
ccgaagcgcggtcatggccgcggtatcgctgtgctcgaagtcgatgaggccaatgttgca
ccagttgccgctcagttaaaacccaaggcctttgttctcaccaatattttccgcgaccag
atggaccgttatggggaattttataccacctatcagaaaattttagacggtgtgacacgc
gatcctgaagcgatggtcattgctaatggcgacgctccgattttcagctcccgaaagctg
cctaatccagtcacctactacggctttgaactcacggcaaatggcgatcataaagccccg
ccgaatacggacggtgtcttatgtccggtatgtcagcacattctgcactaccatgcacaa
acttacgccaatttgggcaattatttttgtccgcattgcggcttcaaacgccccgcttta
acccatcaaatcaccgaggtcacccaaatgaccccacaaagcagcgacttcatgattgat
gatcaaccatgccacatcgacatcggtggcatgtataacatctacaacgcgctcgccgcc
tttgctgttggccgggcgttcggtgttaccccgactgaaatcagccaagcttttgcttat
gacgagaaggtcttcggtcgtcaagaagtcattcaacttggcaagaaaaaattaaccttg
attttggttaaaaacccagtcggcctcaaccaggtcctcagcatgatcgaaaccgccaag
cagccgtttggttttgcaatgctgcttaatgccaattatgcagatggcattgatactagt
tggatttgggacggcaattttgaagaactcgttgccagtcaaaaggctgccagctatttg
gtcggcggcgaacgctacaaggacatcggtttacgccttacagtcgcaggtgtgcccgaa
aaagcgcttgtcagcaagccagctcttgatgatgtcatcagcaccttaaaacgctccccg
caagatcaactttacgttctggccacctatacagcaatgttgcaactacgcaagaaatta
agcgatggcgggtacatcaaagcagggttttag

DBGET integrated database retrieval system