KEGG   Lactobacillus casei BL23: LCABL_13970Help
Entry
LCABL_13970       CDS       T00723                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lcb  Lactobacillus casei BL23
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lcb01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lcb00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1331927..1333117)
Genome map
AA seq 396 aa AA seqDB search
MLNKTRAQSLQQLTVATKDGAIMTEPIALLQKLIQINSVNGNELAVAKLLQAELEAADIP
TKLIPYTEDRVNLIAELNHGDRVLGFTGHEDVVSPGDESAWTYPPFSGKVVDNVMYGRGT
DDMKSGLAAMVLALIALKQSGFTHPIRLIATVGEEYGAMGARLLTEQGYADDLAGLVVGE
PTTKILKYAHAGTVNYEIDSEGVSVHSSRPEKGVNAIDGLTTFAALEHHAFDKAPADPDL
GPFRHSITVINGGDQVNTIPAHAFLRGNLRPTPSANIELVVKMLEDLVAHVNATTNAKLT
LKVLHRFLPVHSDKTGHLVTSANAAIAAVTGKPAELAVAFGGTDASEFIKSTNHFDVIVY
GPGDNHFSHQVNEHIDLNSYTTAIKIYQEIAKRFFE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgctcaacaaaactcgcgcacaaagtctgcaacagctgactgtcgcgacaaaggatggt
gcaatcatgacagaaccaattgccctgctccaaaagctgattcaaatcaattctgtaaat
ggcaacgagctcgccgtcgccaaattgctgcaagccgaacttgaggctgccgatattcct
accaagctgatcccctacacagaagaccgcgtgaatttaattgccgaattaaaccatggt
gatcgcgttctcggtttcactggccacgaagatgttgtgagtcctggagacgagtcagcc
tggacgtacccacctttttccggaaaagtcgtcgacaatgtcatgtatggtcgtggcacc
gatgatatgaaaagcggtttagccgccatggtgctggccctgatcgccctcaaacaatcc
gggttcactcatccgattcgcttgattgcaacggtaggcgaagaatacggtgcgatgggc
gctcgtttgctgacagagcaaggctatgccgatgatctcgctggcttagttgttggtgaa
cccaccactaaaatcttaaaatatgcacatgctggcaccgtgaattacgagattgacagt
gaaggcgtctctgtccatagttctaggcctgaaaaaggcgtcaatgccatcgatggtcta
acgacttttgccgcactggaacatcacgcctttgataaggcgcctgctgacccggatctc
ggcccatttcgacattcaatcacggtcatcaatggcggcgaccaagtcaacaccattcca
gcccacgctttccttcgtggcaatcttcgcccgaccccatcggccaatattgagctggtt
gtgaaaatgcttgaagacttagtggcacatgtcaacgccacgaccaatgcgaaactcacg
ttgaaagtattgcaccgttttctgccggttcactccgataaaacaggccacttggtaact
tcggcaaatgctgccatcgcggcggtaactggtaaaccagctgaattagccgttgcgttt
ggaggaaccgatgcttccgagttcatcaaatcaactaaccattttgatgtgattgtctat
ggccccggtgataaccacttcagtcatcaagtgaatgaacacatcgacctgaacagttac
acaacggcgatcaaaatttatcaagaaattgccaagcgcttcttcgaataa

DBGET integrated database retrieval system