KEGG   Lactobacillus casei BL23: LCABL_15260Help
Entry
LCABL_15260       CDS       T00723                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lcb  Lactobacillus casei BL23
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lcb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1450977..1453445
Genome map
AA seq 822 aa AA seqDB search
MDTREETVTGRVKSIFFQNPTNFFKILLIEISATTITWTESDIVVTGTFGDIKEDATYTF
TGHVVDHPKYGQQFQADNYHADQPTNKSGLVDYLSSDKFPGIGPKTATKIIDHLGMDAID
KILDDPKVLAGLGMTAAKRDMLATNLKSNQGMERVIIGLNDYGFTSNMAGRIYQQYQNDA
LDVIKHNPYQLINDIDGIGFTRADQIAAKLAIAPTSQLRLGGAVMDTLQRLTDGEGDTYV
TLKSLVTQTLDLLERARNVAVSPDAVGQAIVTLAKDNALIAEGDRIFPKRLYDAEWQIGR
QLKGLAEADATATEPELAEIEKTLAAVEADTGIAYDATQRKAIVTALQSPIFLLTGGPGT
GKTTVTDGIVRTYARLHDLSLDLDQYTTDEPFPIMLAAPTGRAAKRISETTQLPASTIHR
LLGLGVDTQEFAPNELPNGLLIIDEMSMVDTYLFRTLLTALHPGMKIVLVGDKDQLPSVG
PGQVFADLLRSGVLPQTALTHIHRQDADSSIIPLAHAVNAGKLPDDFTKPQVDRSFLACA
PSQVPEVVGQVVQRAAVKQFSIADIQVLAPMYRGTAGIDRLNPLLQNILNPKRSARTKAI
QFGETEYRIGDKVLQLVNDPNQNVFNGEIGQIVGITLGKEAESKTDELTIDFDGNEITCK
RSDFNKITLAYATSIHKAQGSEFPMVILPLTLQSRRMLRRNLLYTAITRAKSFLILVGEL
AAFQEAVSEVAVNRHTGLVDRLMTVFGKTVAPQVADDSATKDISASPSEPQIDTTALDLD
NEVKQQPPAAHQLTPALVASQRIDPMIGMDGITPQMFMTKEN
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atggacacgcgtgaggagactgtcaccggtcgggtcaaaagtatctttttccagaatcca
acaaatttttttaaaattcttctgatcgaaatctctgcgacgactatcacctggacagag
tcagatattgtggtgacaggaacgtttggtgatattaaggaagatgcgacctacacgttc
actgggcatgtcgtggatcatcctaagtatgggcagcagtttcaagcagacaattatcat
gcggatcagccgacgaataaaagtgggctggtcgattatttgagctcagataagttcccg
gggatcggtccgaaaacggcaacgaaaattatcgatcatttgggtatggatgctattgac
aagattctggatgatccgaaggttttggcgggcttaggcatgacagctgccaagcgtgat
atgttggcgacgaatctgaaatcgaaccaaggcatggaacgggttattattggtcttaac
gattacggttttactagcaatatggcaggtcgtatttaccaacaatatcaaaatgacgcc
ttagatgtgattaagcacaatccgtatcaattgattaacgatattgatggtatcggcttt
actcgggctgatcagattgcggcaaaattggcgattgcaccgacttcgcagcttcgtctt
ggcggtgcagtgatggataccctgcagcggttgactgatggcgaaggtgatacctatgtg
acgctgaagtcattggtcactcagacacttgatttattggaacgggcgagaaacgttgcc
gtttcgccagacgcagtaggacaggcaattgtgacgctggctaaagacaatgccctgatt
gcagaaggcgaccgcattttcccgaaacgattatatgatgctgaatggcagattggtcgg
caactaaaaggactggcagaggcagacgcaacggctactgaacctgaattggctgagatt
gaaaaaacgttagcggcggtcgaggcggataccggtattgcgtatgatgcgacgcaaaga
aaagccattgtcacggcgttacagtcgcccatttttctgttgactggaggacctggtact
gggaaaaccacagtaacagatggtatcgtgcggacgtatgcacggttgcatgacctttca
ttggatcttgatcagtatacgactgacgagccatttccaatcatgctggcagcgccaacc
gggcgggcagcgaaacggattagtgagaccacccaactgccagccagtacgattcatcgc
ctgctcggtttaggtgttgacacgcaagaatttgcacctaatgagttaccgaatggcctg
ttgattattgatgagatgtcaatggttgacacttacttgttccggacgcttttaacggca
ttacatcccggaatgaaaattgtcttggttggcgataaagaccagttaccaagtgtcggt
cccggacaagtattcgctgatttattgcgcagcggcgtgctgccgcaaacagcgctgacg
catattcatcgtcaggatgccgacagttcaattattccgctagcgcatgcagtgaatgct
ggcaagttgccggatgattttaccaagccgcaagttgatcgcagttttttggcgtgtgcg
cctagtcaggtacctgaagttgtcggacaagtggtgcaacgagccgcagtcaaacaattc
tcgatcgcggatattcaagtgttggcacctatgtaccgcggaaccgctggcattgatcgt
ttgaatccgttactgcaaaacattttgaatccaaaacgcagtgcccgaacgaaagcaatt
cagtttggagaaacggaatatcgaattggtgataaggtgttgcaactggtcaatgatccc
aaccaaaatgtttttaacggtgaaatcggtcagattgtcggcattactttgggcaaggaa
gccgaaagcaagacagatgaattaacgattgatttcgacggcaatgaaatcacttgcaaa
cgcagtgattttaataagattacgcttgcttatgccacctcgattcataaagcccaaggc
agtgagtttccgatggtgattttgccgctaaccttgcaaagccgccggatgttgcgacgt
aacttgttgtacactgccattacgcgggctaaatcatttttgattttggttggcgagctg
gcagcctttcaggaagcggtcagtgaagtagccgttaatcgacatactgggctggtcgat
cggctcatgactgtatttggcaaaaccgttgcccctcaggttgctgatgattcagcaacc
aaggatatttcagcaagtcccagtgagccgcaaattgacacaactgcacttgacttggat
aatgaagttaaacaacaaccaccggcagcgcaccaattaacgcctgccttggtggcttct
caacgaatcgatcccatgattgggatggatggtatcactccgcaaatgtttatgacgaag
gagaattaa

DBGET integrated database retrieval system