KEGG   Lactobacillus casei BL23: LCABL_15840Help
Entry
LCABL_15840       CDS       T00723                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase (Phosphofructokinase) (Phosphohexokinase)
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lcb  Lactobacillus casei BL23
Pathway
lcb00010  Glycolysis / Gluconeogenesis
lcb00030  Pentose phosphate pathway
lcb00051  Fructose and mannose metabolism
lcb00052  Galactose metabolism
lcb00680  Methane metabolism
lcb01100  Metabolic pathways
lcb01110  Biosynthesis of secondary metabolites
lcb01120  Microbial metabolism in diverse environments
lcb01130  Biosynthesis of antibiotics
lcb01200  Carbon metabolism
lcb01230  Biosynthesis of amino acids
lcb03018  RNA degradation
Module
lcb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lcb_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:lcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCABL_15840 (pfkA)
   00030 Pentose phosphate pathway
    LCABL_15840 (pfkA)
   00051 Fructose and mannose metabolism
    LCABL_15840 (pfkA)
   00052 Galactose metabolism
    LCABL_15840 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    LCABL_15840 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LCABL_15840 (pfkA)
Enzymes [BR:lcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LCABL_15840 (pfkA)
Protein phosphatases and associated proteins [BR:lcb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LCABL_15840 (pfkA)
Messenger RNA biogenesis [BR:lcb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LCABL_15840 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CAQ66665
UniProt: B3WE64
Position
1519871..1520830
Genome map
AA seq 319 aa AA seqDB search
MKRIGILTSGGDAPGMNAAVRAVARKAMHEGLEVYGINYGFAGLVAGDIFKMNESTVGDK
IQRGGTMLYSARYPQFAQEEGQLRGVEQLNKFGIEALVVIGGDGSYHGALALTRHGFNTI
GLPGTIDNDIPYTDFTIGFDTAVNTVVEAVDRLRDTAASHERTFVIEVMGREAGDIALWS
GVAGGAEDVIIPEHDFDVKKIASKLQSSRERGQKHAVILLAEGVMHADQFAKELAAHGDF
QLRSTVLGHIVRGGAPSARDRVLASQMGSYAVELLLQGKGALAVGIENNKITAHDVRTLF
DAKHHAELSLYTLAEELTF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggtattttgaccagtggcggggatgcgcctggcatgaacgccgcggtc
cgcgctgttgctcgcaaggcgatgcacgaaggccttgaagtatatggcatcaattatgga
tttgctgggttagttgccggcgacattttcaaaatgaatgaatcaactgtcggtgataag
attcaacgcggcgggaccatgttatattccgcacgttatccacaatttgcgcaagaagaa
ggccagttgcgcggggtcgaacaattaaacaagtttggcatcgaggcgttggtcgtcatc
ggcggagacggctcttatcacggtgcactagctttgacgcgtcacggtttcaacaccatt
ggcctgccaggaacgatcgacaacgatattccttacacggacttcacgattggctttgat
actgccgttaatacagttgtggaagctgttgaccgtcttcgcgataccgcggcttcgcat
gaacgaacctttgtcattgaagtcatgggtcgtgaagctggggacattgccctttggtcg
ggcgtcgccggtggtgccgaggatgtcatcattccagaacacgactttgacgttaagaaa
attgcgtcgaagttgcaaagttctcgtgaacgtggtcaaaagcatgcggtcattcttttg
gcagaaggcgtgatgcacgctgatcaatttgccaaggaattagccgcacatggcgatttc
caattacgttcgacagttctgggacacattgttcgtggcggtgcaccgtccgcacgtgat
cgcgttttggcttcacaaatgggttcatacgcggttgaacttttgttgcaaggcaaaggc
gctttggctgtcggcattgaaaacaacaagatcacggcacatgatgttcggaccttgttt
gatgccaagcatcacgcagaactttcgctctacaccttagcggaagagttaacattttaa

DBGET integrated database retrieval system