KEGG   Lactobacillus casei BL23: LCABL_17860Help
Entry
LCABL_17860       CDS       T00723                                 

Gene name
infB
Definition
(GenBank) Translation initiation factor IF-2
  KO
K02519  
translation initiation factor IF-2
Organism
lcb  Lactobacillus casei BL23
Brite
Translation factors [BR:lcb03012]
 Eukaryotic Type
  Initiation factors
   MTIFs
    LCABL_17860 (infB)
 Prokaryotic Type
   LCABL_17860 (infB)
Mitochondrial biogenesis [BR:lcb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    LCABL_17860 (infB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1729015..1731846)
Genome map
AA seq 943 aa AA seqDB search
MGKKRVYEFAKEMHVDNKDVIDIAKNLGIEVKNHMSSIDQDQEAKIKGMLSKQSAGKAPS
SQAAKTPAKAAKTSSAAHKEAAKKPVAASAKSNDHADVAEHSQKNAKPAAKQENKPARSN
KTSDGKIILSKSTILRPRSTQTAHTNTNHNRGGNTASANNTANGRNSNRSNNNNNNRSAN
NANRSGNNNRSNERNRNDRNRRFDNQRVTGPMPRAGRPTAANGNPRPVAGNGGKFVKPAS
ERQQPKRQEAVKPANAASKRSEQPRTERPRTEQPAATTNQRFTKPAPVPAAAAPKPASAG
SQDNRNSRRGGGNSNFGRSNSYGNRNGFNRNNRRNKKNKRRQQSAPKKEMPQRKERPLPE
TLIYEVGMNAQDLGKILHREPAELIKKLFMLGVMVNQNQSLDKDTIELLATDYGIDAQEK
VHEDISDLDKVFEEENKNQDNLQPRPPVVTIMGHVDHGKTTLLDKLRHTHVTEGEAGGIT
QHIGAYQVKLRDRLITFLDTPGHAAFTNMRARGADITDIVVLVVAADDGVMPQTIEAIHH
AQAAKAPIIVAVNKIDKPGANPDHVMEQLTEYGLIPEDWGGDTIFVKISAKFGKNIDELL
EMILLEADVLELKANPDQKAVGTVIEARLDKGKGPVATVLVQQGTLHTGDPIVVGNTFGR
VRAMTNDHGRRVKDALPSMPVEITGINDVPQSADKFVVFADERTARAAGEERAKRAQEEE
RKNTNHVTLDNLFETMKEGQLKEVDVIIKADVQGSVEALAGSLEKIEVKGVRVNIIHQAV
GAINESDVTLAAASNAIIIGFNVRPTALAKAQAEQDDVDIRLHSVIYKAIEEVEAAMKGM
LEPTYEEKVIGTVTVRETIPVSKVGTVVGGYVDSGYITRDAGVRLVRDGIVKYEGKLGSL
RRFKDDVKEVRQGFELGLTIENYNDIKVDDQIEAFTMEQVPVK
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaaaacgcgtttatgaatttgccaaagaaatgcacgtcgataataaagacgtc
atcgatatcgcgaagaacttgggtatcgaagtaaaaaatcacatgtcctcgatcgatcaa
gatcaggaagctaagatcaaaggtatgttaagcaagcagtcagctggcaaagcaccgtca
tcacaggcagcaaagacacctgctaaagcagccaagacgagttcagcggcacacaaagag
gctgctaagaagccagtcgctgccagtgccaagtcaaacgatcatgctgatgttgctgag
cattcgcaaaaaaacgcaaaacctgctgctaagcaagaaaacaagccggcgcggtcaaat
aagacctctgacggcaaaatcatcttgagcaagtcaacaattttgcgaccacgcagcaca
caaacagcgcataccaacacgaatcacaatcgtggcggcaatacagccagcgctaacaat
acggctaatggccggaattcaaatcgctcaaacaacaataataacaaccgttctgcgaac
aatgctaatcgttccggtaacaataatcggtctaacgaacgtaaccgtaatgaccgtaat
cgtcggttcgataaccaacgcgtcacagggccaatgccgcgtgctggccgtcccacggca
gctaatggcaatccccgtcctgtggcaggcaacggtggcaagtttgttaaaccagcgtct
gaacgtcagcagccaaaacgtcaggaagcggtcaaaccggcaaatgcagcgagtaaacgt
tctgagcaacctcggacggaacggccgcgcactgagcagccagctgcaacaaccaatcaa
cgctttacgaaaccggctccagttccagcggcggcagcaccaaaaccggcaagtgccggc
agccaagacaatcgcaatagccggcgtggcggcgggaacagtaattttggccgcagcaac
agttatgggaatcgtaacgggtttaaccgcaacaaccggcgcaacaagaagaacaagcgc
cgtcaacaaagcgcaccgaagaaggaaatgccgcagcgtaaagagcggccattaccagaa
acactgatttatgaagttgggatgaatgcgcaggatcttggtaagattttgcatcgcgaa
ccagctgaattgattaagaagctcttcatgttgggtgtgatggttaaccaaaaccaaagc
ctcgacaaagataccatcgaattgttggctaccgattacgggattgacgcccaagaaaag
gttcacgaagatatttccgacttggacaaagtgttcgaagaagaaaacaagaaccaagac
aacttacagccacggccgccagttgttactatcatgggtcacgttgatcatgggaagaca
accttgctcgataagctgcgtcacacacatgtgactgaaggcgaagccggcgggattacc
cagcatatcggtgcttatcaagttaaactgcgtgatcggttaattacgttcttggataca
cctgggcatgcggccttcactaacatgcgggcgcgtggtgcggacatcaccgacattgtt
gtgctggtggttgccgctgatgatggtgtgatgccgcagacgattgaagcgattcatcat
gcgcaggcagccaaggcaccgatcatcgttgcagtcaacaagatcgataagccaggcgct
aatccagaccacgtcatggaacaattgacggaatacgggttgattcctgaagactggggc
ggcgacacgattttcgtcaaaatctcagctaaatttggcaagaacatcgatgaattgttg
gaaatgattttacttgaagccgatgtgctcgaactcaaagctaaccctgatcaaaaagcg
gttggtactgtgatcgaagcacgtttggataagggtaagggtcctgttgctaccgtactg
gttcaacaaggtacgctgcatacaggtgatccaatcgttgtcgggaatactttcggccgc
gtccgtgccatgactaatgatcatggccggcgggtcaaagatgctttgccatcaatgcct
gttgaaatcactggtatcaacgatgtgccacaatcggctgacaagtttgttgtctttgcc
gatgaacgcaccgcgcgtgctgctggtgaagaacgggccaagcgggcacaggaagaagaa
cgtaagaacaccaaccatgtcacgttggataatctttttgaaacaatgaaggaaggtcag
ctgaaagaagttgacgtcatcatcaaggccgatgtgcaaggctcagttgaagccttggct
ggcagtcttgagaaaatcgaagttaagggtgttcgggtgaatattattcatcaggccgtt
ggcgcgattaacgaaagtgacgttacccttgcagctgcaagtaacgcgatcatcattggc
tttaacgttcgcccaactgcgctggcaaaagcccaagcagaacaagacgatgttgatatt
cggttgcacagtgtcatttacaaggcgatcgaagaagtcgaagctgcgatgaagggtatg
ctggaaccaacctatgaagaaaaggtgatcggaacagtgactgttcgcgaaacaattccg
gtttctaaggttggtaccgttgtcggtggttatgtcgattccggctatattacacgcgac
gctggtgtccgtctcgttcgcgatggcatcgtcaagtacgaaggtaaactcggctccctg
cgtcgctttaaagacgatgtcaaggaagtccgtcaaggctttgaacttggcctgaccatt
gagaactacaacgacattaaagtcgatgatcaaattgaagccttcacaatggaacaggtt
ccagtgaagtaa

DBGET integrated database retrieval system