KEGG   Lactobacillus casei BL23: LCABL_18750Help
Entry
LCABL_18750       CDS       T00723                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lcb  Lactobacillus casei BL23
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCABL_18750 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCABL_18750 (glk)
   00052 Galactose metabolism
    LCABL_18750 (glk)
   00500 Starch and sucrose metabolism
    LCABL_18750 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    LCABL_18750 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LCABL_18750 (glk)
   00524 Butirosin and neomycin biosynthesis
    LCABL_18750 (glk)
Enzymes [BR:lcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LCABL_18750 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1816463..1817434)
Genome map
AA seq 323 aa AA seqDB search
MTKMNDKKLIGVDLGGTTVKFAILTTDGEIQQRWSIDTNILDEGSHILPDIIDSINEHLK
LYNMTPNDFVGIGMGSPGSVDIEAGTVIGAYNLNWKTLQQAKKDIEAGTGIPFSIDNDAN
VAALGERWKGAGENDANVTFVTLGTGVGGGIIADGNLLHGVAGSAGELGHVTVDPVNGYL
CTCGKRGCLETVASATGVVRVARDMAEEFAGDSKLKQTLDDGDEISSKIVFDLAKTGDKL
ALMIVDRVSYFLGLALANVGNLLNPKFIVIGGGVSAAGDFLLKRVDKYFKENTFPNVRET
TSLRLATLGNTAGVIGAASLALK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagatgaatgacaaaaaattaattggtgtcgatctgggcggcacaacggttaaa
ttcgcgatcttaaccactgatggtgagattcaacagcgctggagcatcgatactaatatt
ttggatgaaggcagtcacatcttgccggatatcattgattcgatcaacgaacatctcaaa
ctctacaacatgacaccgaatgattttgtcggtatcggtatgggctcacctggttccgtt
gatattgaagcaggcacggtaattggcgcttacaacttgaattggaaaaccttgcagcag
gctaagaaggatattgaggctggtactgggattccctttagtattgataacgacgccaat
gttgctgccttgggcgaacgttggaaaggcgctggcgaaaatgacgccaatgtaactttc
gtaacgcttggcacaggcgttggcggcggcattattgccgatggtaacttattgcatggt
gttgcaggctcagcaggcgaactcggacacgtaactgttgatccggtcaatggttatctc
tgtacttgcggcaaacgcggttgtctcgaaactgtagccagtgcgactggcgttgtccgg
gtggcccgggatatggctgaagaattcgctggcgactccaaactgaagcagacgttagat
gatggcgatgagatttctagcaaaattgtttttgatcttgccaaaaccggcgacaaactt
gcgttgatgattgttgaccgggttagctactttcttggcttggcattggcaaatgtcggc
aatctgctgaatccgaaattcatcgtcattggtggcggcgtttcagcagcaggcgacttt
ttgctgaagcgagttgataagtatttcaaggaaaatacgttcccgaatgttcgggaaaca
acaagtctgcgtctggcaacgctaggtaacactgctggcgttatcggagctgccagcctt
gcacttaagtaa

DBGET integrated database retrieval system