KEGG   Lactobacillus casei BL23: LCABL_18750Help
Entry
LCABL_18750       CDS       T00723                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lcb  Lactobacillus casei BL23
Pathway
lcb00010  Glycolysis / Gluconeogenesis
lcb00052  Galactose metabolism
lcb00500  Starch and sucrose metabolism
lcb00520  Amino sugar and nucleotide sugar metabolism
lcb00521  Streptomycin biosynthesis
lcb01100  Metabolic pathways
lcb01110  Biosynthesis of secondary metabolites
lcb01120  Microbial metabolism in diverse environments
lcb01130  Biosynthesis of antibiotics
lcb01200  Carbon metabolism
Module
lcb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lcb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCABL_18750 (glk)
   00052 Galactose metabolism
    LCABL_18750 (glk)
   00500 Starch and sucrose metabolism
    LCABL_18750 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    LCABL_18750 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LCABL_18750 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LCABL_18750 (glk)
Enzymes [BR:lcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LCABL_18750 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: CAQ66954
Position
complement(1816463..1817434)
Genome map
AA seq 323 aa AA seqDB search
MTKMNDKKLIGVDLGGTTVKFAILTTDGEIQQRWSIDTNILDEGSHILPDIIDSINEHLK
LYNMTPNDFVGIGMGSPGSVDIEAGTVIGAYNLNWKTLQQAKKDIEAGTGIPFSIDNDAN
VAALGERWKGAGENDANVTFVTLGTGVGGGIIADGNLLHGVAGSAGELGHVTVDPVNGYL
CTCGKRGCLETVASATGVVRVARDMAEEFAGDSKLKQTLDDGDEISSKIVFDLAKTGDKL
ALMIVDRVSYFLGLALANVGNLLNPKFIVIGGGVSAAGDFLLKRVDKYFKENTFPNVRET
TSLRLATLGNTAGVIGAASLALK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagatgaatgacaaaaaattaattggtgtcgatctgggcggcacaacggttaaa
ttcgcgatcttaaccactgatggtgagattcaacagcgctggagcatcgatactaatatt
ttggatgaaggcagtcacatcttgccggatatcattgattcgatcaacgaacatctcaaa
ctctacaacatgacaccgaatgattttgtcggtatcggtatgggctcacctggttccgtt
gatattgaagcaggcacggtaattggcgcttacaacttgaattggaaaaccttgcagcag
gctaagaaggatattgaggctggtactgggattccctttagtattgataacgacgccaat
gttgctgccttgggcgaacgttggaaaggcgctggcgaaaatgacgccaatgtaactttc
gtaacgcttggcacaggcgttggcggcggcattattgccgatggtaacttattgcatggt
gttgcaggctcagcaggcgaactcggacacgtaactgttgatccggtcaatggttatctc
tgtacttgcggcaaacgcggttgtctcgaaactgtagccagtgcgactggcgttgtccgg
gtggcccgggatatggctgaagaattcgctggcgactccaaactgaagcagacgttagat
gatggcgatgagatttctagcaaaattgtttttgatcttgccaaaaccggcgacaaactt
gcgttgatgattgttgaccgggttagctactttcttggcttggcattggcaaatgtcggc
aatctgctgaatccgaaattcatcgtcattggtggcggcgtttcagcagcaggcgacttt
ttgctgaagcgagttgataagtatttcaaggaaaatacgttcccgaatgttcgggaaaca
acaagtctgcgtctggcaacgctaggtaacactgctggcgttatcggagctgccagcctt
gcacttaagtaa

DBGET integrated database retrieval system