KEGG   Lactobacillus casei BL23: LCABL_19200Help
Entry
LCABL_19200       CDS       T00723                                 

Gene name
yrgI
Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lcb  Lactobacillus casei BL23
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCABL_19200 (yrgI)
   01230 Biosynthesis of amino acids
    LCABL_19200 (yrgI)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCABL_19200 (yrgI)
  Energy metabolism
   00680 Methane metabolism
    LCABL_19200 (yrgI)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCABL_19200 (yrgI)
Enzymes [BR:lcb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LCABL_19200 (yrgI)
Exosome [BR:lcb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LCABL_19200 (yrgI)
  Exosomal proteins of melanoma cells
   LCABL_19200 (yrgI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1856396..1856965
Genome map
AA seq 189 aa AA seqDB search
MATIDLVRHAEPDITIHDDFLRPLTSAGQRQTQQLVDSLHQYPYTAFFSSPLKRAVDTIT
PIADDHGLPVQKNELLVERKMPAWLPNFSDYVNQQWQDLTFFEKPGESIHQVQERYLSFL
YGLPSSAFVAVGSHGTAISSLVEAAIPGIGYHFFSKLGYAAVTRIEMHAGNMVHLTVWEQ
KSKTFNVLK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaattgacttagtgaggcatgctgaaccagacatcacgattcatgatgatttt
ttgcggccactgaccagcgctggtcagcggcaaactcagcagttggttgacagtttgcat
caatatccgtacacggcctttttttcaagcccactcaaacgtgccgttgatacgatcaca
ccgattgcagatgatcacggcttacccgttcaaaaaaacgaactattggtggagcgaaag
atgcctgcatggctgccaaatttttctgactatgttaatcagcagtggcaagatttaaca
ttctttgaaaaacctggtgaatctattcatcaagttcaagaacgttacctttcattttta
tatggactgccaagttcggcattcgtcgctgtcggtagtcatggcacggcgataagcagt
cttgtcgaagcggccatccccggtataggctatcattttttctcgaaacttggttacgcc
gctgtcacccgtatcgaaatgcatgcaggcaatatggttcacctaactgtctgggaacaa
aaatcaaagacatttaacgttctaaaatag

DBGET integrated database retrieval system