KEGG   Lactobacillus casei BL23: LCABL_22590Help
Entry
LCABL_22590       CDS       T00723                                 

Gene name
agaS
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lcb  Lactobacillus casei BL23
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lcb00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lcb00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2197794..2200016
Genome map
AA seq 740 aa AA seqDB search
MANIEYDPERQLFHLHNDTFSYVIQVIRGYLVKRYCGPALDHFSGTAKLEDFSHAFNIQN
DAAPYSLTTLPLEYSTLMGGDYRTPAYAVRNGHGQLIGNLKFDHYQILAGNESFNGTLPT
ARTPHGQTLIITMHDETQTLAVRLKYTIVGDLPVLLKQVEYRNLTDTTLTITHAASLQLD
FDDHAYDLITLTGAHLNEAKVTRQPLTPGKKSIGSNYGASGPQGVPATILAAPATNEFAG
EALGVTLLWSGNFNYTAQVDQFDNSRLVMGLNPELFAWQLKPGKPFVTPEAAVAYTNDGL
NDLSRIFHRFFADHVMPLPRKNLIEYNTWETTYFDVSEAKILAEIPKAEELGVELLVIDD
GWFKNRPNDAGQLGDWVPDPAKFPHGLRPVADAIHARGLAFGLWVEPEMISENSELYATH
PDWAMQYVGQKPLRSRNQLILDLSQRIVQDHLITVLTNLVRDNHIDYLKWDYNRHFSQPG
SPVLPPDQQGEVGYRYTRGLYRVLKTLRDTFPKLLIENCSSGGGRLDGGMIAYTDQTWTS
DFTDPVYRMKIMNGFSLFFPLKIFVSHFTASPNLQDARLTPLHTRALLSLVGITGIECPP
SQLSPAEAAAVKASFAFYKANRKELQNGLLFRLQPSHVNQDEVCWLITNAAKTNALVLTS
VGVTSPIPHYQHVLLHYLDPKLSYQIDKTKNATGLELNHAGVTLPLAHGDFSATLMELTA
VTNLPQTTAAPTLDQITTQS
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatattgaatatgatccggaacgtcaattatttcatttgcacaacgacaccttt
agctatgtcattcaagttattcgcggttatcttgttaaacgatactgcggaccggcgctg
gatcatttttccggtaccgccaaacttgaagacttcagccatgcttttaacattcaaaat
gatgccgcaccttactcactgacgaccttgccgctggaatatagcacattgatgggcggc
gattaccggacgccagcttacgccgtgcgtaacggtcacggtcagctgattggtaatctc
aagtttgaccactatcaaatccttgcaggcaatgaaagctttaacggtaccttgccgaca
gcgcggacaccgcacgggcaaacgctgatcataacgatgcacgatgaaacccagacgctt
gctgtccggctcaaatacacgattgtcggcgatttgcctgtcttgctcaaacaagttgag
tatcgtaatctgacagacacgacactgacgattactcatgctgccagccttcaactggat
tttgacgaccacgcttatgacctcattacgctgaccggtgctcatctcaatgaggccaaa
gtgacccgccagccgctgacccccggcaaaaagtcaatcggcagtaattatggcgccagt
gggccgcaaggtgtcccggcgacgattcttgcagcgccagcgaccaatgaatttgctggg
gaagctttaggcgtcacgcttttgtggagcggcaattttaactatacggcgcaagtcgat
cagttcgacaacagccggctcgtgatgggactgaatccggagctctttgcttggcagctc
aagcccggcaagccatttgtcacgccggaagcagccgtcgcttacaccaacgatggccta
aatgatctcagccggatcttccaccgcttttttgccgatcatgtcatgccattgccgcgc
aaaaacctaattgaatacaacacgtgggaaaccacttattttgacgttagcgaagccaaa
attctagccgagattcccaaagccgaagagttaggagttgagttactggtcattgatgat
ggctggttcaaaaatcggcctaacgatgctggccaacttggcgactgggtacctgatccc
gctaagtttccacatggcctgcgcccggtggctgacgcaattcacgctcgcggccttgct
tttgggctttgggtcgaacccgaaatgatcagcgaaaatagtgagctctatgccacccat
cctgactgggccatgcagtatgtcggccaaaaacctctgcgttctcgcaatcagcttatt
ctcgatctcagtcagcggattgtgcaggatcacttgatcacagttctaactaacctcgtg
cgcgataatcatattgattacctcaagtgggactataaccgccacttcagtcaacctggc
agtccggtactgccacctgatcaacaaggtgaagtcggctatcgctatacccgcggctta
tatcgggttttgaaaacgttacgcgacacttttccaaagctactcatcgaaaattgttcg
tccggcggtggccgtttagatggcgggatgatcgcctacaccgaccaaacatggaccagc
gattttactgacccggtttaccgcatgaaaattatgaacggcttctcgctgtttttcccg
ctcaaaatttttgtctcgcatttcaccgcctccccgaatctacaagatgcgcggttaacg
cccttgcatacccgcgcactgttaagtctggttggcatcactggcatcgaatgcccgccg
agtcagctcagtcccgctgaagccgcggcggtcaaggccagttttgccttttacaaagcg
aatcgcaaagaattgcagaatggtttgctttttcggttacaacctagccatgttaatcaa
gacgaggtttgttggctgatcactaacgccgccaaaaccaatgcactggtcttgacttca
gtcggtgtcacttcgccgattcctcattatcaacatgtactgctgcattacttggaccca
aaattgtcttatcaaatcgacaagacaaaaaatgccaccgggttagaacttaaccacgcc
ggtgttaccttgccacttgcccatggtgatttttcggcaacgctcatggagctgacggcg
gtaaccaaccttccgcaaaccaccgcagcaccgacgcttgatcaaataaccacgcaaagt
tag

DBGET integrated database retrieval system