KEGG   Lactobacillus casei BL23: LCABL_23320Help
Entry
LCABL_23320       CDS       T00723                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lcb  Lactobacillus casei BL23
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lcb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LCABL_23320 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCABL_23320 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LCABL_23320 (thrC)
Enzymes [BR:lcb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LCABL_23320 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2277525..2279039)
Genome map
AA seq 504 aa AA seqDB search
MRYTSTRDHQVSKTSKEAIKQGISEEGGLFVLPHLADQTLNIHELLDLDYETIAQRVLMI
LLPDFNTDSLKKAIHFAYHQHFSDDRITPVRSVGDFHVLELFHGPTSAFKDVGLQLLPRL
MQLALDPDDRVMILAATSGDTGTAALQGFKDVAQTGITVFYPNHGVSPIQERQMLTVGSD
NTRVFPIAGNFDQAQSAVKTLFTDTSFAARLQAEQVTLSAANSINIGRLIPQVVYYFAAY
SQLVKTQAISMGDEVNFTVPTGNFGDVLAGYYAKSLGLPVHKLIVAANANSELADFLATG
VYDRNRPFLKTVAPSMDIQISSNLERLLYYKSGEDSAYVAHLMQELETTGRYQVRPDVLT
AIQADFAGGFAVDEEVADAIREVWHRDGYLLDPHTAVGYAVQQQYRAASGDNTPNVLLAT
ASPYKFPRVVAKALQSHVPDDDFAAMQMLQQVSGVPIPPNLARLQQLRPQEKIVVAPTDM
GQAIIGAAKEVFNDDQRVRSGNER
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatacgagcacacgggatcatcaagttagcaaaaccagcaaagaggcaatcaaa
caaggtatttctgaagaaggcggtttgtttgtcctgccgcatttggccgatcagacgctg
aacattcatgaactgttagatttagattatgaaacgattgctcagcgagttctcatgatc
ctgttgcctgattttaacaccgactcactaaaaaaagcgattcattttgcgtatcatcag
catttttccgatgatcgcatcacgccagttcgttctgtcggggattttcatgtcttagag
ttatttcatggaccaaccagtgcctttaaggatgtcggcttgcagttgcttccgcgcttg
atgcagttggcacttgatcctgatgatcgggtcatgattttagcggcaaccagcggtgat
acgggaacggcggctctgcaagggtttaaagatgtcgcgcagactgggatcacggttttc
tatcctaatcatggtgtcagtccaattcaggagcgccaaatgttgaccgtgggcagtgac
aatacgcgagttttcccaatcgctggcaattttgatcaggcccaaagcgcagtgaaaacc
ctgttcactgacactagctttgctgctcggttgcaggcagagcaagtaaccctgtcagca
gccaactccatcaatattggccgactgattccgcaagttgtgtattattttgcagcgtat
agccagctggttaaaacacaggccatttcaatgggagatgaggttaatttcactgttcca
actgggaattttggcgatgtgttggcgggctactatgctaagagtctaggcttgcctgtt
cataaactaatcgtggccgccaatgccaacagcgaattggctgattttctggcaaccggt
gtgtatgatcgcaaccgaccgtttttgaaaacagtggcacctagcatggatattcaaatt
tccagtaatctggaacgcctgttgtattataagagtggcgaagatagcgcgtatgttgcg
catttaatgcaggaacttgagacgactggtcgctatcaagttcggccggatgtgttgacc
gcgattcaagcggactttgctggcggttttgctgttgatgaagaggtggcagatgccatt
cgcgaggtttggcatcgggatgggtatttgctggatccgcacactgctgttggttatgcg
gttcaacagcagtaccgggcggcgtctggggataacaccccgaatgtgcttttagccacc
gcaagcccttataaatttccacgcgtggtggccaaggcactacaatcgcacgtaccggat
gatgactttgctgcgatgcaaatgttgcaacaggttagcggtgtgccgattccgccgaat
cttgctcgccttcaacagctaagaccgcaggaaaagattgttgtggcaccaaccgatatg
ggccaagctattattggggcggcgaaggaggtattcaacgatgatcagcgtgtccgttcc
ggcaacgagcgctaa

DBGET integrated database retrieval system