KEGG   Lactobacillus casei BL23: LCABL_24040Help
Entry
LCABL_24040       CDS       T00723                                 

Gene name
adh2
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
lcb  Lactobacillus casei BL23
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lcb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LCABL_24040 (adh2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCABL_24040 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    LCABL_24040 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LCABL_24040 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LCABL_24040 (adh2)
   00626 Naphthalene degradation
    LCABL_24040 (adh2)
Enzymes [BR:lcb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LCABL_24040 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2356907..2357947)
Genome map
AA seq 346 aa AA seqDB search
MKAAVFLEPGKVETQDVPKPQLQKPTDAIIKIVRASVCGSDLWWFRGISHRDANSLVGHE
AIGIVEEVGAEVHDIHVGDFVIAPFTHGCGHCAACLAGFDGDCLNQEAGGNGGYQGQYLR
FTNANWALVKIPGQPSDYSDEMLNSFVTLADVMATGYHAAASAEVKQSDTVVVMGDGAVG
LCGVIAAKLRGAKRIIAMSRHEDRQKMAIAFGATDIVPERGDEAVQKVLAMTNGAGADAV
LECVGTEQSVDTATKVGRPGAVVGRVGVPQKPEMNTNNLFWRNIGLRGGIASVTTDDKQL
LLKAVLNGEIHPGKVFTQRFDLEHIQDAYDAMDQRKAIKSLIVVEG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgtttttttagaaccaggtaaagtcgaaacacaagatgtaccaaaaccg
cagcttcaaaagccaactgatgcaatcatcaagattgttcgagccagtgtgtgcggatca
gacttatggtggttccgcggcatctcacatcgagacgctaatagtcttgttggtcatgag
gcgattggcattgtggaagaagtcggtgctgaagttcatgatattcatgtcggtgatttt
gtcattgcgccgtttacacatggttgcggtcactgtgcggcttgccttgccggttttgat
ggtgattgcctgaatcaggaagcaggcggcaatggtggctatcaggggcagtatttacgt
ttcacgaatgcaaactgggccttggttaaaattccgggtcagccgagcgattattcagat
gagatgttgaattcatttgtcacactggctgatgtcatggcgacaggttatcatgctgct
gcaagcgccgaggttaaacaaagcgatacggttgttgtcatgggcgacggggcagttggc
ctttgcggcgtcattgctgccaagttacgcggtgctaagcgcatcattgcgatgagtcgg
catgaagaccggcaaaaaatggcgattgcttttggcgcaactgatattgtacccgaacgt
ggggatgaagcggttcagaaagtcttagcaatgacgaacggcgcaggtgctgatgctgtg
cttgaatgtgttggcactgaacagtcagtggatactgccactaaagtaggtcgtccaggc
gcagttgtgggtcgtgtcggcgtacctcaaaagccagagatgaacacgaataatctgttc
tggcgaaatattggtctgcgtggggggatcgcttcggtcacgacagatgacaaacaattg
ctgctcaaagccgtcttgaatggcgagattcacccaggcaaagtcttcacgcaacgcttt
gatcttgaacatattcaagacgcttatgatgcgatggatcagcggaaggccattaagtca
ctaatcgtggttgaaggttaa

DBGET integrated database retrieval system