KEGG   Lactobacillus casei BL23: LCABL_25210Help
Entry
LCABL_25210       CDS       T00723                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lcb  Lactobacillus casei BL23
Pathway
lcb00010  Glycolysis / Gluconeogenesis
lcb00260  Glycine, serine and threonine metabolism
lcb00680  Methane metabolism
lcb01100  Metabolic pathways
lcb01110  Biosynthesis of secondary metabolites
lcb01120  Microbial metabolism in diverse environments
lcb01130  Biosynthesis of antibiotics
lcb01200  Carbon metabolism
lcb01230  Biosynthesis of amino acids
Module
lcb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lcb_M00002  Glycolysis, core module involving three-carbon compounds
lcb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCABL_25210 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    LCABL_25210 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCABL_25210 (gpmA)
Enzymes [BR:lcb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LCABL_25210 (gpmA)
Membrane trafficking [BR:lcb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LCABL_25210 (gpmA)
Exosome [BR:lcb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LCABL_25210 (gpmA)
  Exosomal proteins of melanoma cells
   LCABL_25210 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAQ67587
Position
complement(2483203..2483874)
Genome map
AA seq 223 aa AA seqDB search
MVKLVLLRHGESIANQKNTYTGWSDVGLTAEGKAQAETAGEKIASTGILFDHVHTSVLSR
AIMTAYIVQDKIGQNYLPITKSWRLNERHYGALRGINKDLTRKLFGPDQVASWRRSFSAH
PPLLANPSRTRRYHRYPATIIPRGESLADASQRLLPYWTAELAPRLLSGKNQLIVAHGST
LRALVKFMEDISDAGINKVEIGNAQPIVYTLDDKLTILDKQTL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtggttaaattagtcctgttaaggcatggcgagagcatcgccaatcagaagaatacttat
accggctggtcggatgtgggtttaaccgcagagggtaaggcacaggctgagacagctggg
gaaaaaatcgcgtccacggggatcttgtttgatcatgttcatacgagcgtgctatcgcgg
gcaatcatgacggcatacatcgtgcaagataagatcggccagaactacctgccgatcacg
aaaagttggcggcttaatgagcggcattacggtgccttacgtggtattaacaaggacttg
acgcgcaagctgtttggcccggatcaggttgcaagttggcggcggagtttttccgcacat
ccgccattacttgctaatcctagtcgaacccggcggtaccaccgttatccagccacgatc
atcccgcgcggcgagagccttgccgatgcgagtcaacggttgttaccgtattggacagct
gaactggcaccgcgccttttgtccgggaaaaatcagctcattgtcgctcacggctctact
ttgcgcgccttggtgaagtttatggaagacatcagcgatgctggcatcaacaaggtcgaa
attggaaatgcgcaaccgattgtttacaccttggatgacaagctaaccattctggataag
caaactttataa

DBGET integrated database retrieval system