KEGG   Lactobacillus casei BL23: LCABL_27570Help
Entry
LCABL_27570       CDS       T00723                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (4-(cytidine-5-diphospho)-2-C-methyl-D-erythritol kinase)
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lcb  Lactobacillus casei BL23
Pathway
lcb00900  Terpenoid backbone biosynthesis
lcb01100  Metabolic pathways
lcb01110  Biosynthesis of secondary metabolites
lcb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lcb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LCABL_27570 (ispE)
Enzymes [BR:lcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LCABL_27570 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: CAQ67808
Position
complement(2710526..2711476)
Genome map
AA seq 316 aa AA seqDB search
MHTTGLAVIVIDRQAYGSPETGGWMELIEKAPAKINLSLDALYRHDDGEHEWQMVMTSVD
LADYVMISPHRSIQVSTDSGFLPEDPRNLAYKAALALQRHANIRQGARIHIEKHIPVAAG
LGGGSSDAAAVLRGLNSLWQLGYSRSQLARIGLSVDSDVPYCVYSETALVTGRGDVVTPL
GSLPNFWVVLAKPRVSVSTPTILNAIDYDAGLRHPDTQTVVAGIQNHDFAQMTSGMANSL
EAITASRYPEMTALKQRLQKYGAEFAQMSGSGPTVFGLCQKHSRAMRVYNSMKGFCREVY
LLRPFCLSATGPRFRG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaacggggcttgcggtgatagtgattgaccggcaagcgtatgggtcgccagag
actggtggttggatggaactgatcgaaaaagcaccggccaagattaatctcagcttggat
gccttgtatcgccatgacgacggcgaacatgagtggcagatggtcatgacatcggtcgat
ttagctgactatgtgatgattagcccgcatcgcagcattcaggtttcgacagatagcggc
ttcctacctgaagatccgcgcaatctggcctacaaagcagcgttggcgctgcagcgtcac
gccaatatccgtcaaggtgcgcggattcatattgaaaaacatattccggtcgccgcgggg
cttggcggcggctcaagtgatgcagctgccgttttgcgagggttgaattcgctttggcaa
ctcggttatagtcggtcacaattagcacggatcggcttaagtgttgatagtgatgtccct
tactgtgtttattcagagacggcgctcgtaactggtcgcggtgatgtggttaccccactt
ggcagcttgccgaatttttgggtcgtgttggcaaagcctcgcgtttcagtatcgacgccg
accattttgaatgccattgattatgacgccggtctgcgccatcctgatacgcaaacggtg
gtggcaggcattcaaaatcatgactttgcacaaatgacgagtggcatggcgaatagcctt
gaagccatcactgctagtcggtatccggaaatgaccgccctcaagcagcggctacaaaag
tatggtgccgaattcgcgcaaatgtcaggcagcggcccaacagtttttggtctgtgccaa
aagcactccagagccatgcgggtttataacagcatgaagggcttttgccgcgaagtttac
ctattacggccattttgcttatccgccacgggtccacggtttaggggttga

DBGET integrated database retrieval system