KEGG   Lactobacillus casei BL23: LCABL_29270Help
Entry
LCABL_29270       CDS       T00723                                 

Gene name
xpk
Definition
(GenBank) Xylulose-5-phosphate phosphoketolase (EC:4.1.2.9)
  KO
K01621  
xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
lcb  Lactobacillus casei BL23
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lcb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LCABL_29270 (xpk)
Enzymes [BR:lcb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     LCABL_29270 (xpk)
    4.1.2.22  fructose-6-phosphate phosphoketolase
     LCABL_29270 (xpk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2885324..2887711
Genome map
AA seq 795 aa AA seqDB search
MDQTIEKTIDYSSKEYLNEVDKYWRAANYLSVGQLYLKDNPLLKRPLKATDVKVHPIGHW
GTIAGQNFIYAHLNRVINKYNLNMFYIEGPGHGGQVMVSNSYLDGSYTELYPKISQDEQG
LQRLFKQFSFPGGVASHADPKTPGSIHEGGELGYSILHGAGAVLDNPDLIAAVVVGDGES
ETGPLATSWQVNKFLNPITDGTVLPILNLNGFKIANPTVLARESHEELVDYFKGLGWDPH
FVEGSDPDKMHPQMAAEMDKIVEEIESIRKNAKDNNDESRPVWPMLVLRAPKGWTGPKTW
DGEPIEGSFRAHQIPIPVDQKDMEHADDLVAWLESYKPKELFNDDGTLKADIEAIIPKGS
LRMAMNPVTNGGILAKHLEKPNPSDYAVDNKDHGANEAQDMTVLGAYIRDLIKLNDKNRN
FRGFGPDETLSNRLNKVFEATNRQWMEPIHKPYDALLASHGRIIDSMLSEHMDEGMLEGY
TLTGRYGFFASYESFLRVVDSMLTQHFKWLRNAHEEADWRADVPALNVIASSTAFQQDHN
GYSHQDPGVISHLAEKKTKYIRAYLPADANTLVRVFDKSVDAKQVINLIVSSKHPRPQWF
TDSEAKSLVEKGLGIIDWASTDQGAEPDLVIAAAGSEPTLESLAAISILHKALPSLRIRF
INVVDLLKLKKDDPRGLSDEEFDMYFTKDKPVIFAYHGYDDLIKDIFFDRHNHNVRVHGY
REEGDITTPFDMRVRNKLDRFNLVKEAVLDVPEFTEKGAHLIQDMDDELQKHHDFIREEG
TDLPEVEEWKWEPLK
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggaccaaacaattgagaaaactatcgattattcctcaaaggaatatttgaatgaggtt
gataaatactggcgggctgctaactatctgtccgttgggcaactgtacctgaaggacaat
ccgttactgaagcgacccttgaaggcaactgatgtcaaagttcatccgattgggcattgg
ggcaccattgcaggtcagaatttcatttatgctcatctgaaccgggtcatcaataaatac
aacctgaatatgttttacattgaaggtccgggacatggcggccaagtcatggtctctaat
tcttatcttgatggcagttatacagagctctatccaaaaatttctcaagatgagcaagga
ttgcaacgtttattcaaacaattttcattcccgggtggcgttgcgtctcacgccgatccc
aagacgcctggatcaattcatgaaggcggtgaattgggctattccatccttcatggcgct
ggtgccgttcttgataatccggatctcattgccgcagttgttgttggtgatggtgaatct
gaaacaggtccacttgccacctcttggcaagtaaataagtttttgaacccaattacagac
ggtaccgttttgccaatcttgaacttaaatggtttcaaaatcgccaatccaacggttctt
gctcgggagtcgcacgaagagttagtggactactttaaaggtctcggttgggatccacat
tttgttgaaggatcggatcctgataagatgcatccccaaatggcagctgagatggataaa
atcgtcgaagaaattgagtctattcgtaaaaatgccaaagataacaatgacgagagtcgt
ccagtttggccaatgcttgttttacgggcaccaaagggttggacaggtcctaagacgtgg
gatggcgagccaattgaaggctccttccgtgcgcatcaaatcccgattccggtggatcaa
aaagacatggaacatgcagacgatctagtcgcttggttggaatcatacaaaccaaaggaa
cttttcaatgacgatggcaccctcaaagctgacattgaagccatcattcctaaaggcagc
cttagaatggcaatgaatcctgttaccaatggcggcattcttgccaaacatctcgaaaaa
ccaaatccgagcgattatgctgtggacaataaggatcacggtgctaatgaagcgcaggat
atgactgtgctcggcgcttatatccgggatctcatcaaattgaatgataagaacagaaac
ttccgcggatttggaccagacgaaaccttatccaatcgtttaaacaaggtttttgaagcc
accaatcggcaatggatggaaccgatccataaaccttatgatgccttactagctagccat
ggtcggattattgactcaatgctatcggaacacatggatgaaggcatgctggagggatac
acgttaactggtcgttatggtttctttgccagctacgagtccttcttacgggtggttgat
tccatgcttacccagcatttcaagtggttacggaatgcacacgaagaagctgattggcgg
gctgatgtacctgccttaaacgttatcgcctcttctactgctttccagcaagaccacaat
ggctactcgcatcaggatcccggtgtcatcagtcatctagctgaaaagaagacaaagtat
attcgcgcttatctgccagcagacgcgaacaccttggttcgtgtcttcgataaatccgtt
gatgctaaacaagtcattaatctgattgtttccagcaaacatccacgaccacaatggttc
acagattcagaggcaaagtctttggttgaaaaaggtctgggtatcattgattgggcaagc
acggatcaaggtgcagaacctgatttggttattgccgcggctggttcagaaccaacactt
gagagcttggctgccatctcaatcttgcacaaggcattgcctagtttgaggatccgcttc
atcaatgtcgttgatttgttaaaacttaagaaagacgaccctcgcggcctatcagatgaa
gagtttgatatgtactttacaaaagacaaaccggtcatctttgcttatcacggctacgat
gatctgatcaaggacattttcttcgatcgtcataatcacaacgttcgcgttcacggctat
cgtgaagaaggtgacatcacgacaccatttgatatgcgtgttcgtaacaagttggaccgc
tttaacttggtcaaagaagccgttctcgatgtccctgaattcaccgaaaaaggtgcccat
ctcattcaagatatggatgatgagcttcagaagcaccacgacttcatccgcgaggaaggt
accgatttacctgaagttgaagagtggaaatgggaaccgttaaagtag

DBGET integrated database retrieval system