KEGG   Liberibacter crescens: B488_02160Help
Entry
B488_02160        CDS       T02395                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lcc  Liberibacter crescens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lcc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B488_02160
   00052 Galactose metabolism
    B488_02160
   00500 Starch and sucrose metabolism
    B488_02160
   00520 Amino sugar and nucleotide sugar metabolism
    B488_02160
Enzymes [BR:lcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     B488_02160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
250509..251402
Genome map
AA seq 297 aa AA seqDB search
MISFKKLRKAVFPVAGFGTRLLPSTKAVPKEMVTVVDKPVIQYIVDEALEAGLTHFVFVT
GRGKCLIEDYFDIQFELEQSLKKREKKAELTLLSDILPQAGTAIFTRQQEPHGLGHAVWC
ARHIIDDEPFALLLPDMLMQAQGDNCTKGMVKLYNKSGGNVVAVEECDPDLSHKYGIVGV
GDFIDNESFLITDMIEKPSPGMAPSNFFINGRYILQPEIFSILETQERGAGGEIQLTDAM
LKLTASQTFSAYLFKGNTYDCGSKEGFVLANIAFALSREDVRSNIEDDLKNLLDALR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgatatcgtttaagaaactccgtaaggcagttttccctgttgcgggttttggaacacgt
cttcttccgtccactaaagctgttccaaaggaaatggtaacggtggtcgacaaaccggta
attcaatatatagtagacgaagctcttgaagctggtttaacacattttgtttttgttaca
ggacgtggaaaatgtttgatagaagattatttcgatattcagtttgaattagaacaatct
ttaaaaaaaagagaaaaaaaagctgaattaactttattatctgatattttgcctcaagct
ggtactgctatatttacacgtcaacaagagccacatggtcttgggcatgctgtatggtgt
gctcgacatattattgatgatgaaccatttgctttgttgttgcctgatatgttgatgcag
gctcaaggtgataattgtacaaaaggtatggttaagctttataataaaagtggtggtaat
gttgtagcagttgaggagtgtgatcctgatttgtctcataagtatggaattgtaggcgta
ggagattttattgataatgaaagctttttgattactgatatgattgaaaagccatcgcct
ggtatggctccgtcaaatttttttattaatggacgttacattttacagcctgaaatcttt
tcaatacttgaaactcaggaaagaggagcaggaggcgaaattcaactaacagatgctatg
cttaaattgacagcgagtcagactttttctgcttatctttttaaaggaaatacttacgat
tgtgggtctaaggaaggttttgtcctggcaaatattgcttttgcactttctcgagaagat
gtacgttctaatatagaagatgatctcaagaatcttctagatgcattacgataa

DBGET integrated database retrieval system