KEGG   Liberibacter crescens: B488_03440Help
Entry
B488_03440        CDS       T02395                                 

Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lcc  Liberibacter crescens
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lcc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
395325..395936
Genome map
AA seq 203 aa AA seqDB search
MIGKLKGNIEEICEDYLLLDVQGVCYTVYCSARTLKAIGKAGDSCVLFIETHVRQDQIRL
FGFFSTLDRDLFILLQSVQGIGVRIALAILSTLTSVELINAIVLQDKTIIVRSPGIGEKV
AGRIVSELKEKVSHLIRKTDTCLTFKQNVDQDNALLSDVISALANLGYTRDQATIAVSSV
FRSLDGVVDDSQLIRLALKELSR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgattggcaagcttaaaggaaatatcgaagaaatatgtgaagactatttgttgcttgat
gttcaaggagtttgttatactgtatattgttcagcgcgtactttaaaggcaattggtaaa
gctggtgattcttgtgttttatttattgagacacacgtacgccaagatcagatacgatta
tttggttttttttctacactagatcgagacttgtttattcttttacaaagtgtacaaggg
attggggtaaggatagcattagcaattttatcgactttaacatccgttgaattaataaat
gctattgtgttgcaagataaaacaataattgtccgttctcctggaattggagaaaaagtt
gctggtcgtatagtaagtgagctcaaagaaaaggtttctcatctcataagaaaaacagat
acatgtttaacttttaaacagaatgtagatcaggataatgcattgttgtcagatgtgata
tcggcattagctaatttagggtatactcgtgatcaggcaacaatcgcagtttcttctgtt
tttaggagccttgatggagttgttgatgattctcaattaatccggttggcgttgaaggaa
ttgtctcgctag

DBGET integrated database retrieval system