KEGG   Liberibacter crescens: B488_03440Help
Entry
B488_03440        CDS       T02395                                 

Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lcc  Liberibacter crescens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lcc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    B488_03440
Enzymes [BR:lcc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     B488_03440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
395325..395936
Genome map
AA seq 203 aa AA seqDB search
MIGKLKGNIEEICEDYLLLDVQGVCYTVYCSARTLKAIGKAGDSCVLFIETHVRQDQIRL
FGFFSTLDRDLFILLQSVQGIGVRIALAILSTLTSVELINAIVLQDKTIIVRSPGIGEKV
AGRIVSELKEKVSHLIRKTDTCLTFKQNVDQDNALLSDVISALANLGYTRDQATIAVSSV
FRSLDGVVDDSQLIRLALKELSR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgattggcaagcttaaaggaaatatcgaagaaatatgtgaagactatttgttgcttgat
gttcaaggagtttgttatactgtatattgttcagcgcgtactttaaaggcaattggtaaa
gctggtgattcttgtgttttatttattgagacacacgtacgccaagatcagatacgatta
tttggttttttttctacactagatcgagacttgtttattcttttacaaagtgtacaaggg
attggggtaaggatagcattagcaattttatcgactttaacatccgttgaattaataaat
gctattgtgttgcaagataaaacaataattgtccgttctcctggaattggagaaaaagtt
gctggtcgtatagtaagtgagctcaaagaaaaggtttctcatctcataagaaaaacagat
acatgtttaacttttaaacagaatgtagatcaggataatgcattgttgtcagatgtgata
tcggcattagctaatttagggtatactcgtgatcaggcaacaatcgcagtttcttctgtt
tttaggagccttgatggagttgttgatgattctcaattaatccggttggcgttgaaggaa
ttgtctcgctag

DBGET integrated database retrieval system