KEGG   Liberibacter crescens: B488_05270Help
Entry
B488_05270        CDS       T02395                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
lcc  Liberibacter crescens
Pathway
lcc00220  Arginine biosynthesis
lcc00250  Alanine, aspartate and glutamate metabolism
lcc00471  D-Glutamine and D-glutamate metabolism
lcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B488_05270
   00220 Arginine biosynthesis
    B488_05270
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    B488_05270
Enzymes [BR:lcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     B488_05270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase FmrO
Motif
Other DBs
NCBI-ProteinID: AGA64519
UniProt: L0ESP8
Position
569284..570210
Genome map
AA seq 308 aa AA seqDB search
MDLQSIVDDIYQELSTHIGKGRSVTYIPELEKVNIHQFGIAVATPEGSVFKAGDASIKFS
TQSIAKVFLLTIVLKRVGEKLWKRVGREPSGSSFNSIVQLENEEGIPRNPFMNSGAIVVT
DEILVNKTPAEAIDDFLSFVHNITLDKSVYIDHIVAASEFSTTYRNFALANFMCSYGNII
HKVEDVLDVYCHLCALTMNCIQLAKAGLYLVVQGYNPITGKRVISPEQARRINAIMFTCG
HYNNSGDFAYRVGLPGKSGVGGGILAIAPKKASIAVWSPGLNEVGNSLVGEMALELLTHK
TGWSVFEP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggatttacaatcaatagttgatgatatttatcaagaattaagcactcatattggtaag
ggtcgttctgttacctatattccagaactagagaaagtaaatattcatcaatttggtatc
gcagttgctactcctgagggcagtgtttttaaagctggtgatgcaagtatcaaattctca
actcagagtatagcaaaagtttttcttttaacaattgttctcaaaagagttggtgaaaag
ctttggaagcgcgttgggcgtgagccttctggctcttcttttaattctatagtgcaactt
gaaaatgaggagggtattccacgtaatccttttatgaattctggcgctatagttgttaca
gatgaaatcctagtgaataaaacaccagcagaagcaatagatgattttttgagttttgtg
cataatattacattagataagtctgtttatattgaccatattgtggctgcttccgagttt
tctacaacatatcgtaattttgctttagctaattttatgtgttcttatggaaatattatt
cataaggttgaagatgttctggatgtttactgtcatttatgtgctttgacgatgaattgt
atacaactggcaaaggcgggtttgtatttggttgttcaaggttataacccgataacgggt
aagagagtcatttctcctgagcaagcgcgacgaattaatgcaatcatgtttacttgtggc
cattataataattctggtgattttgcatatcgtgttggtttacctggaaaaagtggtgtc
ggtgggggtattcttgctattgctccgaaaaaagcatctattgctgtatggtcccctgga
ttgaacgaagtaggaaattctcttgttggcgaaatggctcttgaacttttaactcataaa
acaggttggtctgtttttgaaccctga

DBGET integrated database retrieval system