KEGG   Liberibacter crescens: B488_05270Help
Entry
B488_05270        CDS       T02395                                 

Definition
Glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
lcc  Liberibacter crescens
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lcc00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:lcc00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:lcc00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
569284..570210
Genome map
AA seq 308 aa AA seqDB search
MDLQSIVDDIYQELSTHIGKGRSVTYIPELEKVNIHQFGIAVATPEGSVFKAGDASIKFS
TQSIAKVFLLTIVLKRVGEKLWKRVGREPSGSSFNSIVQLENEEGIPRNPFMNSGAIVVT
DEILVNKTPAEAIDDFLSFVHNITLDKSVYIDHIVAASEFSTTYRNFALANFMCSYGNII
HKVEDVLDVYCHLCALTMNCIQLAKAGLYLVVQGYNPITGKRVISPEQARRINAIMFTCG
HYNNSGDFAYRVGLPGKSGVGGGILAIAPKKASIAVWSPGLNEVGNSLVGEMALELLTHK
TGWSVFEP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggatttacaatcaatagttgatgatatttatcaagaattaagcactcatattggtaag
ggtcgttctgttacctatattccagaactagagaaagtaaatattcatcaatttggtatc
gcagttgctactcctgagggcagtgtttttaaagctggtgatgcaagtatcaaattctca
actcagagtatagcaaaagtttttcttttaacaattgttctcaaaagagttggtgaaaag
ctttggaagcgcgttgggcgtgagccttctggctcttcttttaattctatagtgcaactt
gaaaatgaggagggtattccacgtaatccttttatgaattctggcgctatagttgttaca
gatgaaatcctagtgaataaaacaccagcagaagcaatagatgattttttgagttttgtg
cataatattacattagataagtctgtttatattgaccatattgtggctgcttccgagttt
tctacaacatatcgtaattttgctttagctaattttatgtgttcttatggaaatattatt
cataaggttgaagatgttctggatgtttactgtcatttatgtgctttgacgatgaattgt
atacaactggcaaaggcgggtttgtatttggttgttcaaggttataacccgataacgggt
aagagagtcatttctcctgagcaagcgcgacgaattaatgcaatcatgtttacttgtggc
cattataataattctggtgattttgcatatcgtgttggtttacctggaaaaagtggtgtc
ggtgggggtattcttgctattgctccgaaaaaagcatctattgctgtatggtcccctgga
ttgaacgaagtaggaaattctcttgttggcgaaatggctcttgaacttttaactcataaa
acaggttggtctgtttttgaaccctga

DBGET integrated database retrieval system