KEGG   Liberibacter crescens: B488_06980Help
Entry
B488_06980        CDS       T02395                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lcc  Liberibacter crescens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B488_06980
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B488_06980
   00052 Galactose metabolism
    B488_06980
   00500 Starch and sucrose metabolism
    B488_06980
   00520 Amino sugar and nucleotide sugar metabolism
    B488_06980
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    B488_06980
   00524 Butirosin and neomycin biosynthesis
    B488_06980
Enzymes [BR:lcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     B488_06980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(775500..776540)
Genome map
AA seq 346 aa AA seqDB search
MIDSSSRDFPLSFPVLLADIGGTNARFAVLPDRDSEMVLFPKVSTLNFDTLEQAIQQTVL
EKVSCQPSSSILAVAGPAGGPNVKLTNYKWSIEPTTLFTQTSLEDILVINDFAAQALAIA
DISEKNYAPVGHCNVFDIKKNNFASRVILGPGTGLGIAALIRSKNCWIPVSGEAGHIDIG
PRSKRDFEIFPYLEKIGGRISAEQLLSGRGLMNIYKAICAADKIKDITCPQSQEITASRS
HDPVAYETIKLFCQYLGRVAADIALVFMALGGVYLSGGIPENIIEALSEDDFEVSFKDKA
PHQAFMSKIPTYRITHPCIALLGMASYVRNFNNYSLIEGASQRWFR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgattgattcttcaagcagagatttccctctttcttttcctgttcttcttgctgatatt
ggaggaacaaatgccaggtttgctgtattaccggatagagattcagagatggtccttttc
cctaaggtgagtacactaaactttgacactttagagcaagctattcaacagacagttctt
gagaaagtatcctgtcaacctagttcttctatccttgctgttgctggacctgctggcggt
cctaatgttaaattaacaaattataaatggtctattgagccaacaacattatttacccag
acatcccttgaagatattcttgtgattaatgattttgcagcacaggcattggcgatagca
gatatttctgaaaagaattatgcgcctgttggtcattgtaatgtttttgatataaaaaag
aataattttgcatcccgggtcattcttggcccaggaacaggattgggtattgccgccttg
atacggagtaagaattgttggattccagtttctggagaggcaggacatattgatattggg
ccacgttcaaaacgtgattttgaaatttttccttatcttgaaaagattggaggacgtatt
tcagctgaacaattgctctctggaagggggcttatgaatatttacaaggctatttgcgct
gctgataaaattaaagacataacatgtcctcaatctcaggaaattactgcctccagatcc
catgatcctgttgcttatgaaacaataaaacttttttgccagtaccttggcagggttgct
gctgatattgcgctggtttttatggcgcttgggggtgtttatctttctggtggcatccct
gaaaatatcatagaagccttgtccgaggatgactttgaggtatcctttaaagataaggct
cctcatcaggcttttatgagcaagatacctacgtatagaataacccatccttgtattgct
ctccttggcatggcttcctatgttcgtaatttcaataattactctttgatagaaggagca
agtcaacgctggtttcgttaa

DBGET integrated database retrieval system