KEGG   Liberibacter crescens: B488_07160Help
Entry
B488_07160        CDS       T02395                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lcc  Liberibacter crescens
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lcc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    B488_07160
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B488_07160
Enzymes [BR:lcc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     B488_07160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(797976..799304)
Genome map
AA seq 442 aa AA seqDB search
MFIAEALQRGAIAIVISSAISLDSEIISILKKQKVPFFSVVNPRRFLSLAASRIYKKQPK
VIVAVTGTSGKTSVTSFVRQIWQYGGYSSAQIGTIGIISNNACYQSSLTTPDPVYLAQKM
EEFVSEGITHVAIEASSHGLDQHRLDGLHLFAGAFTNLGRDHMDYHATVDDYFLSKMRLF
KELLPKGAPAIIWSDDSWSEKVIDIAQKSDCRVRTVGQKGTFIHLEKNDSSKDTPEVLLR
IDGEVFKINFPLLGTFQLNNALVAAGLCIATDMEIPLVVNALQSLQSAPGRLEFIGQSRL
GGKIYIDYAHNPESLEIILKTVRAFTIGRVVVVFGCGGDRDKGKRPLMGKIALELADVVI
VTDDNPRSENPSRIRAEIIGSLDMIEIGDRKEAICAAINMLKKNDTLIIAGKGHEEVQIM
DQQKIIRFSDREEIRQFLKNDS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtttattgctgaggccttgcaacgcggagcaattgcaattgtaatttcttctgccata
tcattggattcagaaataatttcgattctgaaaaagcaaaaagttccttttttttctgtt
gtcaatccaagaaggtttctttctttagctgcgtcaaggatatacaaaaaacagccaaaa
gttattgttgcggttacaggtacatctggaaagacatctgttacatcttttgttcgtcag
atttggcaatatgggggatattcttctgctcaaattggaactatcggtattatttcaaac
aatgcatgctatcagagttcattaacaacacctgatccagtttatttggcacaaaaaatg
gaagagtttgtttctgaaggaattactcatgttgcaattgaagcgtcaagtcatggcctt
gatcagcacaggcttgatggcttgcatcttttcgctggggcattcaccaatttagggcgt
gatcatatggattatcatgctacggtggacgattattttttaagtaaaatgcgtcttttt
aaagaattacttcctaaaggagcaccagcaattatttggtctgatgattcctggtcagaa
aaagtaatcgatattgctcaaaaatcagactgtcgagtacggacagttggtcaaaaaggt
acttttattcatttagaaaaaaatgattcttcaaaagatactccagaggttttattacgt
attgacggagaagtttttaaaataaattttcctcttttaggaacatttcagcttaataat
gctttggttgcggcaggattgtgtattgcaacggatatggaaattcctcttgttgtcaat
gctttacaaagcttgcaatcggctcccgggagacttgaatttattggtcagagtagacta
ggagggaaaatttatattgattatgcccataatcctgaatctcttgaaataattttgaaa
actgtcagagcttttacaatcggtcgtgttgttgttgtttttggctgtggaggtgatcgt
gataaaggtaaaaggccattaatgggcaaaattgctttagaattggctgatgttgtgatt
gttacagatgataatcctcgttcggagaatccatcgagaattcgtgctgaaattattgga
tctttggatatgattgagataggagatcgtaaggaagctatttgtgcagctattaatatg
ttaaagaaaaatgatactttaattattgctggtaaggggcatgaagaagtacagattatg
gaccagcagaagattatccgattttctgaccgtgaagaaatacgtcaatttctaaaaaat
gactcatga

DBGET integrated database retrieval system