KEGG   Liberibacter crescens: B488_07410Help
Entry
B488_07410        CDS       T02395                                 

Definition
(RefSeq) Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lcc  Liberibacter crescens
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B488_07410
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B488_07410
  Amino acid metabolism
   00310 Lysine degradation
    B488_07410
Enzymes [BR:lcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     B488_07410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(825162..826343)
Genome map
AA seq 393 aa AA seqDB search
MATEILVPSLGESVSEATVSVWLKKVGDTVQVDEALLELETDKVTIEVPASVSGVLTELL
VAEGETVTRGGLLGYISESSENPVTAPVSLKKTDDIDSSGISNQMPPSPSAIKMISENNI
PLSDIQGTGKRGQILKNDVESAMSKKSSNVISIIPAEKKDSIGEERVKMTRLRQTVAKRL
KDAQNVAAILTTYNEVDMLSIINLRKKYKDSFEKTHGVKLGFMGLFTKAVCQALKEIRNI
NAEIDGTDIVYKDYCHIGIAVGTDKGLVVPVVRDADQMSVAEIEQEISRLGKAARDGYLS
VADMQGGTFTISNGGVYGSLLSSPILNPPQSGILGMHKIQERPVALNGEVVIRPMMYIAL
SYDHRIVDGKEAVTFLVRVKESLESPERIVLEI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggctacagaaattttggttccttctttaggagaatctgtcagtgaagctactgtaagt
gtttggcttaagaaagttggcgatactgtacaggttgatgaagctttattggaacttgaa
acagataaggttaccattgaggttccggcttctgtttctggtgtattaactgagcttttg
gttgcagaaggagagacagttactcgtggaggattgcttgggtatatttctgaatcttca
gaaaatcctgtaacagcccctgtctctcttaagaaaacagacgatattgattcttctgga
atttctaatcagatgcctccatctccatctgcgattaaaatgatttctgaaaacaatatt
ccgctttctgatatacagggtacaggaaaaaggggacaaatccttaagaatgatgtagaa
tcagcaatgtcgaagaaatcctccaatgttatttctatcattcctgctgaaaagaaagat
tctattggcgaggagcgtgtaaaaatgacgcgtctacgccagactgtagctaaacgtctt
aaagatgctcaaaatgttgcagctattcttacgacctataatgaggtcgatatgctgtcc
attattaatcttagaaagaagtataaggattcgttcgagaagacgcatggtgtaaaatta
ggttttatgggcttatttacgaaagctgtttgtcaggcattaaaagaaatcagaaatatt
aatgcagaaattgatggaacagatattgtttataaggactattgtcatatcgggattgct
gttggtactgacaaaggtcttgttgttcctgttgttcgtgatgcagatcagatgagtgtt
gcagaaattgagcaagaaataagtcgtcttggcaaggctgctcgtgatggttatttatct
gtagctgatatgcagggggggacgtttacaatttctaatggaggggtttacggttctctt
ttatcttctccgattttgaatcctccgcaatcaggaattcttggtatgcataagattcag
gaacgtccggttgctttaaatggagaggtggtcattcgtcctatgatgtatattgccttg
tcttatgatcatcgtattgttgatggcaaggaagcggttacattccttgttcgtgttaag
gaaagccttgaaagtcctgagcgtattgttctggaaatttaa

DBGET integrated database retrieval system