KEGG   Liberibacter crescens: B488_07440Help
Entry
B488_07440        CDS       T02395                                 

Definition
succinyl-CoA ligase (ADP-forming) subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lcc  Liberibacter crescens
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B488_07440
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B488_07440
   00640 Propanoate metabolism
    B488_07440
   00660 C5-Branched dibasic acid metabolism
    B488_07440
Enzymes [BR:lcc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     B488_07440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(830281..831477)
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKALLKSYGAPVAEGVVIFSPDEVVDALKKLPGPLYVVKSQIHAGGRGKGKFK
NLGSDARGGVRLETSAEAVIADVHEMMGSLLVTNQTDVSGKQVNRIYIEDGADISRELYL
SLLVDRSVGQVSFIASVQGGMDIEEVAKHTPEKIIKVLVNHFDGVTSKDVSCLCDLLELD
GMARDDAANLFPVLYKAFIENDMSLLEINPLIVMKNGRLRLLDAKVSFDGNALFRHPDLQ
ALRDISEEDGKEVEAKKHGLSYIALNGNIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKDAVAAAFKIITSDASVQGILINIFGGIMRCDVLAEGVLSAVKEVGIRVPLVLRLE
GANVDLGNKMIADSGLNVITANDLDDAAQKIIHAVKGV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaagctaaggctttattaaaatcttatggagcgccagttgct
gaaggtgtcgttatcttctctcctgatgaggttgtggatgctttgaaaaagcttcctggt
cctttatatgtcgttaaaagccaaattcatgctggcggtcgtggtaagggaaagtttaaa
aatctgggttctgatgcaagaggtggtgtgcgtttagagacttctgctgaggctgttatt
gctgatgttcatgagatgatgggttctctgctggtgaccaaccagacggatgtttccggt
aagcaggttaaccgtatttatattgaggatggcgctgatatttcgcgtgaactttatctt
tctcttcttgtggatcgttctgttggtcaggtatcttttattgcttctgtccagggtgga
atggatattgaggaagttgcgaaacacactcctgaaaaaattatcaaggttttggtcaac
cattttgatggtgtgacatcgaaagatgtttcttgtttatgtgatttgcttgaacttgac
ggaatggcccgggatgatgcggcgaatctttttcctgtcttgtataaggcatttattgaa
aatgatatgagccttttggaaataaatcctctgattgttatgaaaaatggtcgtcttcgt
cttcttgatgccaaagtttcatttgatggtaatgctttgttcaggcatccagatcttcag
gccttgagagatatttctgaagaggatggtaaagaggttgaggccaagaagcatggtctt
tcatatattgcccttaacgggaatataggatgtatggttaatggagcgggtttggctatg
gcaacgatggatattatcaagttgtatggagcagagcctgctaattttcttgatgttgga
ggaggagcaagtaaagatgctgttgccgcagcatttaaaattatcacttctgatgcgtcc
gttcagggtatactcattaatatatttggaggcatcatgagatgcgatgttcttgcagaa
ggtgttttgtctgctgtaaaggaagtcggtataagagttcctctggtattacgtcttgaa
ggggcaaatgttgatcttggaaataaaatgatagccgatagtggattaaatgtgattact
gcaaatgatcttgatgatgcagctcaaaaaattattcatgcagtaaaaggagtttaa

DBGET integrated database retrieval system