KEGG   Liberibacter crescens: B488_07440Help
Entry
B488_07440        CDS       T02395                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lcc  Liberibacter crescens
Pathway
lcc00020  Citrate cycle (TCA cycle)
lcc00640  Propanoate metabolism
lcc01100  Metabolic pathways
lcc01110  Biosynthesis of secondary metabolites
lcc01120  Microbial metabolism in diverse environments
lcc01130  Biosynthesis of antibiotics
lcc01200  Carbon metabolism
Module
lcc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lcc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lcc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B488_07440
   00640 Propanoate metabolism
    B488_07440
   00660 C5-Branched dibasic acid metabolism
    B488_07440
Enzymes [BR:lcc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     B488_07440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AGA64736
UniProt: L0EWI0
Position
complement(830281..831477)
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKALLKSYGAPVAEGVVIFSPDEVVDALKKLPGPLYVVKSQIHAGGRGKGKFK
NLGSDARGGVRLETSAEAVIADVHEMMGSLLVTNQTDVSGKQVNRIYIEDGADISRELYL
SLLVDRSVGQVSFIASVQGGMDIEEVAKHTPEKIIKVLVNHFDGVTSKDVSCLCDLLELD
GMARDDAANLFPVLYKAFIENDMSLLEINPLIVMKNGRLRLLDAKVSFDGNALFRHPDLQ
ALRDISEEDGKEVEAKKHGLSYIALNGNIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKDAVAAAFKIITSDASVQGILINIFGGIMRCDVLAEGVLSAVKEVGIRVPLVLRLE
GANVDLGNKMIADSGLNVITANDLDDAAQKIIHAVKGV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaagctaaggctttattaaaatcttatggagcgccagttgct
gaaggtgtcgttatcttctctcctgatgaggttgtggatgctttgaaaaagcttcctggt
cctttatatgtcgttaaaagccaaattcatgctggcggtcgtggtaagggaaagtttaaa
aatctgggttctgatgcaagaggtggtgtgcgtttagagacttctgctgaggctgttatt
gctgatgttcatgagatgatgggttctctgctggtgaccaaccagacggatgtttccggt
aagcaggttaaccgtatttatattgaggatggcgctgatatttcgcgtgaactttatctt
tctcttcttgtggatcgttctgttggtcaggtatcttttattgcttctgtccagggtgga
atggatattgaggaagttgcgaaacacactcctgaaaaaattatcaaggttttggtcaac
cattttgatggtgtgacatcgaaagatgtttcttgtttatgtgatttgcttgaacttgac
ggaatggcccgggatgatgcggcgaatctttttcctgtcttgtataaggcatttattgaa
aatgatatgagccttttggaaataaatcctctgattgttatgaaaaatggtcgtcttcgt
cttcttgatgccaaagtttcatttgatggtaatgctttgttcaggcatccagatcttcag
gccttgagagatatttctgaagaggatggtaaagaggttgaggccaagaagcatggtctt
tcatatattgcccttaacgggaatataggatgtatggttaatggagcgggtttggctatg
gcaacgatggatattatcaagttgtatggagcagagcctgctaattttcttgatgttgga
ggaggagcaagtaaagatgctgttgccgcagcatttaaaattatcacttctgatgcgtcc
gttcagggtatactcattaatatatttggaggcatcatgagatgcgatgttcttgcagaa
ggtgttttgtctgctgtaaaggaagtcggtataagagttcctctggtattacgtcttgaa
ggggcaaatgttgatcttggaaataaaatgatagccgatagtggattaaatgtgattact
gcaaatgatcttgatgatgcagctcaaaaaattattcatgcagtaaaaggagtttaa

DBGET integrated database retrieval system