KEGG   Liberibacter crescens: B488_07500Help
Entry
B488_07500        CDS       T02395                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
lcc  Liberibacter crescens
Pathway
lcc00020  Citrate cycle (TCA cycle)
lcc00190  Oxidative phosphorylation
lcc00650  Butanoate metabolism
lcc01100  Metabolic pathways
lcc01110  Biosynthesis of secondary metabolites
lcc01120  Microbial metabolism in diverse environments
lcc01130  Biosynthesis of antibiotics
lcc01200  Carbon metabolism
Module
lcc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lcc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lcc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:lcc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B488_07500
   00650 Butanoate metabolism
    B488_07500
  Energy metabolism
   00190 Oxidative phosphorylation
    B488_07500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: AGA64742
UniProt: L0EUV4
Position
complement(837269..837649)
Genome map
AA seq 126 aa AA seqDB search
MDMRSPLGKVLGLGSAKDGTTHFWHQRLTSIAILPFVIFFMAFMLIYSNASYDEVVSVLS
DPFVFIIMVLGLGTVFFHMKLGMQVIIEDYIHSKLLRYSLIIMNTFFVFLMTAFSFFCLI
KILFMR
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggatatgcgtagccctttagggaaagtacttggcttgggttctgcaaaggatggaaca
acccatttttggcatcagcgccttacatcaattgctatacttccttttgtcatttttttt
atggcattcatgcttatctatagcaatgcttcttacgatgaggttgtgtccgttctttct
gatccatttgtttttattataatggttttgggtttgggtacggtgttctttcatatgaaa
ttgggaatgcaggttattattgaggattatattcattccaagcttttgagatatagcttg
attattatgaatacattttttgtttttttaatgacagcgttttcctttttttgtcttata
aaaattttattcatgcggtag

DBGET integrated database retrieval system