KEGG   Liberibacter crescens: B488_07560Help
Entry
B488_07560        CDS       T02395                                 

Definition
uroporphyrinogen-III synthase protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lcc  Liberibacter crescens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lcc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
841792..842484
Genome map
AA seq 230 aa AA seqDB search
MRVVITRPQKSAIRTAERLSKMGHEAIIMPLSYFTYNLSLVRMALKKPYAAVAITSAEAL
CTIPEEISPSLDTIVFAVGNASAAAAQNHGFKNIFSGTGNGISLAKEIIKQRDILSPEKP
LLYLAGRPRSPGFEETLCQNFIPFTAIDCYLAHDISYSSKDTERLLAKIDVILFYSRENV
VRFFALPLPDRIMARFLCLSAQVASAIPDPYKKDIAVANSPDENALLELL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgttgtaataacccgacctcaaaaatcagcgatacggacagcagagcgattatcg
aagatgggacatgaagccataatcatgcccttatcctattttacctataatctttctctt
gtccgaatggccttgaaaaaaccttacgcagcggtagccattaccagcgcagaagcatta
tgtacaatccctgaagagatctctccttctcttgacaccattgtttttgctgtaggaaat
gcaagtgctgccgctgcacaaaatcatggctttaaaaatatattttccggaacagggaat
ggtataagtttggcaaaagaaatcatcaaacaacgagacatattaagcccggagaaacca
cttctctatttggcaggacgtccgagatcccctggcttcgaggaaaccctctgccaaaat
ttcattccttttacagccattgattgctatcttgcacatgatatttcttattcttccaaa
gatacagagcgtcttcttgcaaaaattgatgttatcctgttttattccagagaaaatgtc
gtgcgtttttttgcattacccttgcctgacaggatcatggcccgtttcttatgtttaagc
gctcaggttgcaagtgcaatacctgatccctataaaaaagatattgctgtcgccaattct
ccagacgaaaatgctctattagaattactttga

DBGET integrated database retrieval system