KEGG   Liberibacter crescens: B488_08350Help
Entry
B488_08350        CDS       T02395                                 

Definition
glutathione S-transferase (EC:2.5.1.18)
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
lcc  Liberibacter crescens
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:lcc00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
911412..912026
Genome map
AA seq 204 aa AA seqDB search
MKLYFTPGSCSLAPHIALQESGIHHTITKVDLSTHKLEDNTDYYTINSRGSVPLLVLDNG
EQITETAVILQYIADQAPEKKLAPAHGTLARVRLQETLNFIATKLHKGTGLFFNPKVDES
TKLLFRQRLRNFHEMMNKKISETGWLIGHQFTVADAYLYVVMRWAIKLDLDISGLDSIAD
FMKRMKERPMDEAYERKTHGCSCT
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctattttactcctggttcatgctcacttgcccctcatattgcattacaggaa
tctggtatccatcatactattactaaagtcgatcttagcacgcataaacttgaagacaac
acagactattacactattaattccagaggctctgttccccttctcgtcctcgacaacggt
gaacagattaccgagactgctgtcatccttcagtatatcgccgaccaggcgcctgaaaag
aagctcgcacctgctcatggtacgttagcacgtgtacgtcttcaagaaacattaaatttt
attgcaacaaaactccacaagggtactggtttatttttcaatccaaaagttgatgaatca
acaaaactattgttccgacaaaggctacgcaactttcatgaaatgatgaataaaaagatc
tcggagactggttggcttattggtcatcaattcactgtggcagatgcctatctttatgtc
gttatgagatgggccatcaagcttgatctggatataagcggccttgattccattgcagac
tttatgaagcgtatgaaagaaagacccatggatgaagcgtatgaaagaaagacccatggt
tgcagctgcacttaa

DBGET integrated database retrieval system