KEGG   Liberibacter crescens: B488_09550Help
Entry
B488_09550        CDS       T02395                                 

Definition
(GenBank) Aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lcc  Liberibacter crescens
Pathway
lcc00240  Pyrimidine metabolism
lcc00250  Alanine, aspartate and glutamate metabolism
lcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    B488_09550
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B488_09550
Enzymes [BR:lcc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     B488_09550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace 2-Hacid_dh_C UDPG_MGDP_dh_C
Motif
Other DBs
NCBI-ProteinID: AGA64947
UniProt: L0EVF9
Position
join(1028153..1028416,1028416..1029075)
Genome map
AA seq 307 aa AA seqDB search
MYFFSLRHFISMKDLTEQDICYLLDQAEGYLTTNRQRNKKTSTLKGLTHINLFFEASTRT
QTSFEIAGKRLGADVINISLNNSSIKKEETFLDTVATLNAMHPDLLVIRHPCSGTMKFLL
QEIHGPTLINAGDGTHEHPTQALLDALTIRSVKGHLENLIVTICGDILHSRVARSNIILL
NTMGAHVRVVGPKTLLPARIEDMGVKVFHTMEEGLKDADVIMMLRPQNERMLGVFIPSIQ
EYSYYYSINVKNIKIAKEDALVMHPGPMNRGVEISSAIADGSQSVIQKQVEMGIAVRMAV
IQELLRH
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtattttttttcattgcgtcattttatcagtatgaaagatcttactgaacaagatatt
tgttatcttcttgatcaagcagaaggatacctaacaactaatcgtcagcgcaataaaaaa
acttcaactttaaagggtcttacgcatattaaccttttttttgaagcatctactcgaaca
caaacttcttttgaaattgctggaaaacgacttggagctgatgtcatcaatatatcattg
aacaattcgtctataaaaaaggaggaaacatttctcgatactgtagcaacattaaatgct
atgcatccagatcttcttgtgattcgtcatccctgttctggtacaatgaaatttctcttg
caagagattcatggccccactctcattaatgctggagatggaacacatgaacacccgaca
caagcactgcttgatgccctaacgatacgaagtgtcaaaggtcatttagaaaatctcatc
gtcacaatttgtggtgatattcttcactctcgtgttgcccgctctaatattatattgctt
aatacaatgggagcacatgtaagagttgttggcccaaaaaccctcttgccagcacgtata
gaagatatgggagttaaagtgttccatactatggaagaaggattaaaagacgcagacgtg
ataatgatgttacgaccccagaatgaaaggatgttaggagtatttataccatcaatacaa
gaatattcatattattattccatcaacgtaaagaacatcaaaatcgcaaaggaggatgcg
cttgtcatgcatcctggccctatgaatcgtggtgttgagatttcttctgcaattgcagat
ggatcccaaagtgttattcaaaaacaagttgaaatgggaattgctgttcgtatggctgtt
atacaagaacttctccgacattaa

DBGET integrated database retrieval system