KEGG   Liberibacter crescens: B488_09700Help
Entry
B488_09700        CDS       T02395                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lcc  Liberibacter crescens
Brite
Enzymes [BR:lcc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     B488_09700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1048972..1049643)
Genome map
AA seq 223 aa AA seqDB search
MITYEAARVQMVNTQLRTSDVTSYPILSAFLEIPREAFVPQELKQFAYFDEHLQIKPSSH
TSPARYLMAPMPIAKLLQLAKVDKKSKVLEIGAASGYVTALLSQLASSVVALESDSYLFK
SASETLSSLGYRNVTIINAPLEAGYQPSSPYDVIFLNGSVETIPLALIEQLNENGRLIAV
KGYDQAAKSWVYIKRFGKVSSYPSFNVNLKPLPGFCKDDEFIF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgataacatatgaagccgctcgtgtacaaatggtgaatacacagcttaggacttctgat
gttacttcttatccgatacttagtgcgtttttagaaatacctcgtgaagcttttgttcct
caagaattaaaacaatttgcttattttgatgagcatttgcagattaaaccatcatcacat
acttctccagcacgttatcttatggcaccaatgcctattgctaaacttcttcagcttgca
aaggtggataaaaaaagtaaagttttagaaattggtgctgcatcgggatatgtaacggct
ttgttatcccagttggcttcatcagttgttgcgcttgaaagtgattcttatctttttaaa
tctgcttcagaaacgttatcttcactaggttatagaaacgttactataatcaacgctcca
ttagaagcaggctatcaaccttcttcaccatatgatgttatatttttaaatggttctgtt
gaaacaattcctctggcgctcattgagcaactgaatgaaaatgggcgtttaatagctgtt
aaaggatatgatcaggctgcaaagtcttgggtatatataaaaagatttggcaaggtttct
agttatccaagttttaatgtaaacttaaaaccgcttcctggattttgtaaggacgatgaa
tttattttttga

  All links  
No link information was found.   
DBGET integrated database retrieval system