KEGG   Liberibacter crescens: B488_09700Help
Entry
B488_09700        CDS       T02395                                 

Definition
(GenBank) Protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lcc  Liberibacter crescens
Brite
Enzymes [BR:lcc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     B488_09700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_12 Methyltr_RsmB-F Methyltransf_11 MTS DREV DUF938 Methyltransf_18 Methyltransf_PK
Motif
Other DBs
NCBI-ProteinID: AGA64962
UniProt: L0EVH6
Position
complement(1048972..1049643)
Genome map
AA seq 223 aa AA seqDB search
MITYEAARVQMVNTQLRTSDVTSYPILSAFLEIPREAFVPQELKQFAYFDEHLQIKPSSH
TSPARYLMAPMPIAKLLQLAKVDKKSKVLEIGAASGYVTALLSQLASSVVALESDSYLFK
SASETLSSLGYRNVTIINAPLEAGYQPSSPYDVIFLNGSVETIPLALIEQLNENGRLIAV
KGYDQAAKSWVYIKRFGKVSSYPSFNVNLKPLPGFCKDDEFIF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgataacatatgaagccgctcgtgtacaaatggtgaatacacagcttaggacttctgat
gttacttcttatccgatacttagtgcgtttttagaaatacctcgtgaagcttttgttcct
caagaattaaaacaatttgcttattttgatgagcatttgcagattaaaccatcatcacat
acttctccagcacgttatcttatggcaccaatgcctattgctaaacttcttcagcttgca
aaggtggataaaaaaagtaaagttttagaaattggtgctgcatcgggatatgtaacggct
ttgttatcccagttggcttcatcagttgttgcgcttgaaagtgattcttatctttttaaa
tctgcttcagaaacgttatcttcactaggttatagaaacgttactataatcaacgctcca
ttagaagcaggctatcaaccttcttcaccatatgatgttatatttttaaatggttctgtt
gaaacaattcctctggcgctcattgagcaactgaatgaaaatgggcgtttaatagctgtt
aaaggatatgatcaggctgcaaagtcttgggtatatataaaaagatttggcaaggtttct
agttatccaagttttaatgtaaacttaaaaccgcttcctggattttgtaaggacgatgaa
tttattttttga

DBGET integrated database retrieval system