KEGG   Liberibacter crescens: B488_10430Help
Entry
B488_10430        CDS       T02395                                 

Definition
GTP cyclohydrolase I type 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
lcc  Liberibacter crescens
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lcc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1138257..1138853)
Genome map
AA seq 198 aa AA seqDB search
MSYSDLKPVKPTLKEVEEAVKTIIRWIGDDPEREGLKDTPARVVKSYAELFDGYNKSIDN
MAASSFEEVGGYNDIVLLKDIPFFSHCEHHIVPIIGKAHIAYFPEKRVIGLSKIVRIVNL
YAHRLQTQEKITAQIANGMEKVLHSRGVAILVEGEHMCMSMRGIRTVNVKTITTSFTGVF
SNISENQSRFMKMVGYDR
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgtcttattctgatttgaaacctgtaaagcccactttaaaagaagtagaggaagctgta
aaaacaattattaggtggataggggatgacccagaacgtgaagggcttaaagatacacct
gcccgcgttgtcaaatcatatgccgaactctttgatggttacaataaaagtattgataat
atggcggcttcttcttttgaagaggttggtggttataatgatattgtcttattaaaggac
attccatttttttcacattgtgagcaccatatcgtgccaattattggtaaagcacatata
gcatatttccctgaaaaacgtgttattggcttgtcaaaaattgttcgtattgtaaatctt
tatgcgcatcgattgcaaacacaagaaaaaataaccgcccagattgctaatggtatggag
aaagttctgcattctcgaggtgttgctattcttgttgaaggtgagcatatgtgcatgtcc
atgcgtgggattcgaacagtaaatgttaaaaccattaccacttcttttacgggtgtattt
tctaatatatctgaaaatcagagtcgttttatgaaaatggttggttatgacagatga

DBGET integrated database retrieval system