KEGG   Liberibacter crescens: B488_10430Help
Entry
B488_10430        CDS       T02395                                 

Definition
GTP cyclohydrolase I type 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
lcc  Liberibacter crescens
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B488_10430
Enzymes [BR:lcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     B488_10430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1138257..1138853)
Genome map
AA seq 198 aa AA seqDB search
MSYSDLKPVKPTLKEVEEAVKTIIRWIGDDPEREGLKDTPARVVKSYAELFDGYNKSIDN
MAASSFEEVGGYNDIVLLKDIPFFSHCEHHIVPIIGKAHIAYFPEKRVIGLSKIVRIVNL
YAHRLQTQEKITAQIANGMEKVLHSRGVAILVEGEHMCMSMRGIRTVNVKTITTSFTGVF
SNISENQSRFMKMVGYDR
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgtcttattctgatttgaaacctgtaaagcccactttaaaagaagtagaggaagctgta
aaaacaattattaggtggataggggatgacccagaacgtgaagggcttaaagatacacct
gcccgcgttgtcaaatcatatgccgaactctttgatggttacaataaaagtattgataat
atggcggcttcttcttttgaagaggttggtggttataatgatattgtcttattaaaggac
attccatttttttcacattgtgagcaccatatcgtgccaattattggtaaagcacatata
gcatatttccctgaaaaacgtgttattggcttgtcaaaaattgttcgtattgtaaatctt
tatgcgcatcgattgcaaacacaagaaaaaataaccgcccagattgctaatggtatggag
aaagttctgcattctcgaggtgttgctattcttgttgaaggtgagcatatgtgcatgtcc
atgcgtgggattcgaacagtaaatgttaaaaccattaccacttcttttacgggtgtattt
tctaatatatctgaaaatcagagtcgttttatgaaaatggttggttatgacagatga

DBGET integrated database retrieval system