KEGG   Liberibacter crescens: B488_11460Help
Entry
B488_11460        CDS       T02395                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
lcc  Liberibacter crescens
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:lcc00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1242589..1243281
Genome map
AA seq 230 aa AA seqDB search
MPTLYHHIMSSSSRFIRLILNEYDYETEMIEEFPWEKRHDFLVLNPAGTLPVYVDDSMRA
LCGATVISEYIDETQGVLKRNRRLLAEDPFQRAEIRRLTEWFLQKMENDVTRPLVRERVY
KLQMTRDQGGGAPDSKVLRTARNNIRQHMKYISWLSSSRTWLAGLRLSYADLAAGASISV
LDYLGEINWLDSPESKDWYQRLKSRPSFRPLLSERIRGLAPVSHYTDLDF
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccctttatcatcacattatgtcatccagctcacgttttatacgtcttattttg
aatgaatatgattatgaaactgaaatgatcgaagagttcccctgggaaaaacgtcatgat
tttttagttcttaatccagcagggacattaccagtatatgtagatgacagcatgcgtgct
ctttgtggtgcaacagtgatttctgagtatattgatgaaacacaaggtgttcttaaacgg
aatcgtcgcttattagcagaagatccttttcagcgggctgaaatccgtagattaacagaa
tggtttttgcaaaaaatggaaaacgatgttacaagaccattggttcgtgaacgtgtttat
aaattacaaatgactcgtgatcaaggcggtggtgctcctgattcaaaggtgttgcgtaca
gctcgtaataatattcgtcaacatatgaaatatatttcatggttatctagttcacgtaca
tggttagctggactgcgccttagctatgcagatcttgctgccggagcttctatttctgtt
ctcgattatcttggagaaattaattggcttgactcacctgaatctaaagattggtaccaa
cgacttaaatctagaccatcatttcgccctttactttctgaacgtatccgaggattggca
ccagtctctcactatactgaccttgatttttaa

DBGET integrated database retrieval system