KEGG   Lactobacillus casei LC2W: LC2W_0062Help
Entry
LC2W_0062         CDS       T01956                                 

Definition
hypothetical protein
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lce  Lactobacillus casei LC2W
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lce01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lce00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lce00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(71559..72353)
Genome map
AA seq 264 aa AA seqDB search
MSKLADVFKNHKVFIPFIVADDPDFETTVKNVVALAKGGADIVELGIPFSDPVADGPVIQ
AADLRAFAANVRTKTVFDIVEAARKETAVPIVFLTYLNIVFKYGYEAFLKRCADLNVAGL
VIPDLPYESRDEIVPIAEKYGIDIIPLITPTSGHRIEKIAKSASGFIYVVSSMGITGERD
EFFAGLKALVAEIKQYTNVPTAIGFGIHTPEQAQTMAGIADGVIIGSAIVDLVAKEKQQA
PAAIEKFTKQIRVSVDAKKQISVK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagttagcagatgtttttaaaaatcataaagtctttatccccttcatcgtcgct
gatgatcccgattttgaaaccaccgtcaaaaacgtggtcgcacttgccaaaggtggcgcc
gatattgtggagttaggcatccctttttccgatccagtcgccgacggtcccgtgattcaa
gccgccgacctaagagcattcgccgccaacgttcgcaccaaaacggtctttgacattgtg
gaggctgcccgcaaagaaaccgcggtgccaatcgtcttcctaacttacttgaacattgtc
ttcaaatacggctacgaagccttcttaaaacgctgtgcggatttaaatgtcgccggcttg
gtgattccagatctgccatatgaaagtcgcgatgaaattgtgccaattgccgaaaaatac
ggtatcgatattattccgttaatcacgccaacttccggtcatcgaattgaaaaaatcgcc
aaaagtgcctcaggatttatctatgtcgtttcctcaatgggcattactggcgaacgcgat
gaattctttgctggcttaaaggcattagtcgcagaaattaagcagtataccaacgttcca
accgctatcggtttcggcattcacacgcctgaacaagcacaaacaatggcaggcatcgcc
gatggtgtcatcatcggcagcgccatcgttgatcttgtcgcgaaggaaaaacaacaggca
ccggctgcgattgaaaagtttactaagcagatccgagtgtccgttgatgctaaaaagcaa
atttcggtgaaataa

DBGET integrated database retrieval system