KEGG   Lactobacillus casei LC2W: LC2W_0063Help
Entry
LC2W_0063         CDS       T01956                                 

Definition
hypothetical protein
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lce  Lactobacillus casei LC2W
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LC2W_0063
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LC2W_0063
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LC2W_0063
Enzymes [BR:lce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LC2W_0063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(72346..73566)
Genome map
AA seq 406 aa AA seqDB search
MKTLNETTQQSTRAGRYGKDFGGQYIPETLMTELEKVTKAFNDLKDNPEFKAELNDLLVN
YANRPSLLYYAKNMTEDLGGAKIYLKREDLNHTGAHKINNVIGQALLAKHLGKKRLIAET
GAGQHGVATATIAALMGMDCEIFMGKEDTDRQKLNVYRMELLGAKVHPVTSGSMVLKDAV
NATLQEWASRSDDTFYVLGSAVGPAPFPEMVKHFQSVISTESKQQLQAKETRLPDMVVAC
VGGGSNAIGSFAAYIDDPSVQLVGVEAAGKGVDTDRTAATIERGSVGIFHGMKSLFMQNE
DGQIDPVYSISAGLDYPGVGPEHAALAQEGRAQYVGITDDEAVEAFTYIAKQEGIVAAIE
SCHAIAYVEKIAPQMAKDQIIICTLSGRGDKDVASIAKYKGVDVDE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaagacattaaatgaaacaacccaacagtcaacacgcgccggtcgttatggaaaagac
tttggcggccagtatattcctgaaaccctcatgaccgagcttgaaaaagtaactaaggct
ttcaatgacttaaaagataatcctgaatttaaagcagaattaaatgatctattggttaat
tacgccaatcgcccctcgttgctttattatgccaagaacatgaccgaagaccttggtggc
gccaaaatctacttaaaacgggaagatttaaatcataccggtgcacataagatcaataat
gtcatcggtcaggccttgcttgccaaacatttaggcaaaaagcgcctgattgccgaaacc
ggcgccggtcaacatggtgtcgctaccgccaccattgccgcactcatggggatggactgt
gaaattttcatgggtaaagaagacactgaccgtcaaaagttaaacgtttatcgcatggaa
cttctcggcgcaaaggttcatccagtcacaagcggatcaatggttttaaaagacgcggtt
aacgccacactgcaagaatgggcgagtcgcagtgatgacactttctacgtgttaggttct
gcagtcggccctgcgccgttccccgaaatggtgaaacattttcaaagtgttatttcaacg
gaatcgaaacagcaacttcaggccaaagaaactcggctgccagacatggtcgttgcctgt
gtaggtggtggcagtaacgccattggaagttttgctgcttacattgatgatccttctgtt
caattagtcggcgttgaagcagccggtaaaggcgttgataccgacagaaccgccgcaact
atcgaacgcggctccgttggcattttccacggcatgaagtccttattcatgcaaaatgaa
gatggccagattgatccggtctattccatttctgctggccttgattaccccggcgttggt
cccgagcatgccgctctcgctcaggaaggccgggcgcaatacgttggcattaccgacgac
gaagcagttgaagcctttacctacattgcgaaacaagaaggcattgttgccgccattgaa
agctgtcacgccatcgcctacgttgaaaagattgccccacagatggcaaaagatcaaatc
attatctgtaccttgtccggacgtggcgataaggacgtcgcaagcattgccaaatacaaa
ggagtcgatgttgatgagtaa

DBGET integrated database retrieval system