KEGG   Lactobacillus casei LC2W: LC2W_0065Help
Entry
LC2W_0065         CDS       T01956                                 

Gene name
trp1
Definition
(GenBank) Anthranilate synthase component 2
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lce  Lactobacillus casei LC2W
Pathway
lce00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lce01100  Metabolic pathways
lce01110  Biosynthesis of secondary metabolites
lce01130  Biosynthesis of antibiotics
lce01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lce00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LC2W_0065 (trp1)
Enzymes [BR:lce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LC2W_0065 (trp1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh His_biosynth QRPTase_C PDZ IMPDH DHO_dh ComA PEP_mutase ThiG
Motif
Other DBs
NCBI-ProteinID: AEA52401
Position
complement(74177..74959)
Genome map
AA seq 260 aa AA seqDB search
MILDDLVTVTKIRLARHQRQQSLADLKQTVAKMPRNHKPDFLTRLKQPGLHVIAEVKKAS
PSKGTIVTDFPYLAIAKAYDQAGADAISVLTEPDYFNGHLHYLKEISQQVSVPTLRKDFT
IDPYMIYEAKANGAVIILLIVAILTDQQLRDYRQLAEKLGMHAIVEAYTAAEVTRALQSG
AKIIGINNRNLKDFRVDFNNSLKLRAMVPDNIPVVAESGIKTQEDVEKLAAAGFNAILIG
ETLMRSNQKRQLIAAFKERA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgatcttagacgatttggtgactgtgaccaaaattcgtttagcgcgtcaccaacgccaa
cagtcacttgctgatttaaaacaaaccgtggccaaaatgccgcgcaatcacaagccggat
tttctaacacgcttaaaacaacctggcctacacgtgatcgctgaggtcaaaaaggcctcg
ccatcaaaggggacaattgtcacagattttccctacttggcgatcgccaaagcgtacgat
caagccggtgccgatgctatctcggtcttgaccgaacccgattatttcaacggccacctt
cattatctaaaggaaatcagccaacaagtgtcggtgccaacgcttcgaaaagattttacg
attgatccttatatgatctacgaggctaaggcaaacggggctgtcattattttactgatt
gttgcgatcctaaccgatcagcaattgcgcgattatcgccaactggctgaaaaactcggt
atgcacgcaattgtcgaggcctatacagccgctgaggtcacacgggcactacagtcaggt
gcaaagataatcggcattaacaaccggaatctcaaagactttcgagttgatttcaacaat
agtttgaaattaagagccatggtgcccgacaacatccccgtcgttgcggaaagcggcatt
aagacgcaggaagacgttgaaaaactggcagcagctggcttcaatgccattctcatcggt
gaaacactcatgcgatctaaccaaaagagacaattaattgcagcatttaaagaaagagcg
tga

DBGET integrated database retrieval system