KEGG   Lactobacillus casei LC2W: LC2W_0065Help
Entry
LC2W_0065         CDS       T01956                                 

Gene name
trp1
Definition
Anthranilate synthase component 2
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lce  Lactobacillus casei LC2W
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LC2W_0065 (trp1)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LC2W_0065 (trp1)
Enzymes [BR:lce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LC2W_0065 (trp1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(74177..74959)
Genome map
AA seq 260 aa AA seqDB search
MILDDLVTVTKIRLARHQRQQSLADLKQTVAKMPRNHKPDFLTRLKQPGLHVIAEVKKAS
PSKGTIVTDFPYLAIAKAYDQAGADAISVLTEPDYFNGHLHYLKEISQQVSVPTLRKDFT
IDPYMIYEAKANGAVIILLIVAILTDQQLRDYRQLAEKLGMHAIVEAYTAAEVTRALQSG
AKIIGINNRNLKDFRVDFNNSLKLRAMVPDNIPVVAESGIKTQEDVEKLAAAGFNAILIG
ETLMRSNQKRQLIAAFKERA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgatcttagacgatttggtgactgtgaccaaaattcgtttagcgcgtcaccaacgccaa
cagtcacttgctgatttaaaacaaaccgtggccaaaatgccgcgcaatcacaagccggat
tttctaacacgcttaaaacaacctggcctacacgtgatcgctgaggtcaaaaaggcctcg
ccatcaaaggggacaattgtcacagattttccctacttggcgatcgccaaagcgtacgat
caagccggtgccgatgctatctcggtcttgaccgaacccgattatttcaacggccacctt
cattatctaaaggaaatcagccaacaagtgtcggtgccaacgcttcgaaaagattttacg
attgatccttatatgatctacgaggctaaggcaaacggggctgtcattattttactgatt
gttgcgatcctaaccgatcagcaattgcgcgattatcgccaactggctgaaaaactcggt
atgcacgcaattgtcgaggcctatacagccgctgaggtcacacgggcactacagtcaggt
gcaaagataatcggcattaacaaccggaatctcaaagactttcgagttgatttcaacaat
agtttgaaattaagagccatggtgcccgacaacatccccgtcgttgcggaaagcggcatt
aagacgcaggaagacgttgaaaaactggcagcagctggcttcaatgccattctcatcggt
gaaacactcatgcgatctaaccaaaagagacaattaattgcagcatttaaagaaagagcg
tga

DBGET integrated database retrieval system