KEGG   Lactobacillus casei LC2W: LC2W_0203Help
Entry
LC2W_0203         CDS       T01956                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lce  Lactobacillus casei LC2W
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lce00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lce00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
207456..209009
Genome map
AA seq 517 aa AA seqDB search
MALSLRACILLLKEHHLLKSAAIQNTEDVDMTGIAYDSRKVSGPTLFFCKGDKFRPIYLS
MAKDNGARTYVAEKPYVEGNGLNALIVRNITKAMAILSAAFFDYPQDDLFVIAYTGTKGK
TTASYFTEAILNEARPRHIALFSTIDTVVGPESDQRFKSNLTTPESLDLFRDMREAVENG
MTHLVMEVSSQAYLRNRVFGLTYDVGFFLNITPDHIGPNEHPTFANYLHNKLQLLVNARK
VVINAETEHFDQVYAAATTTTYPESIYLFASAGFRPKRDDIDIDFRFDSQEADVAESRFT
LVPVTEKAAALNIGGHYSLALIGDFNESNATAAIIGAGLAGVDASAAVPGIAKVKIPGRM
EHTKVAGHGAVYVDYAHNYASMKALLSFLKHAYKDPRLLVVVGSPGDKGVSRRPGFAKVL
TEFATEAFLTTDDPGYEDPANIIEEIDSKIDHSKVKVHKVLDRQKAIAEAISDSRPNDIV
VVAGKGADPYQKVRGVNTPWPTDMAVVKQVAKSLQEG
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcactatcacttagagcatgtatcttattattaaaggaacatcatctgctaaagagt
gcagcaattcagaatactgaagatgtcgatatgaccggcatcgcctatgattcacgcaag
gtctctggaccaacgctgtttttctgcaaaggcgacaagttccgaccaatttatctttcc
atggccaaggacaacggtgcgcgaacttatgttgccgagaaaccttacgttgaaggcaac
ggcttaaacgccttgatcgtgcggaatattactaaagcaatggcgattttgagcgctgct
ttctttgattatccgcaagatgatttgtttgtgatcgcttatacaggaaccaaggggaaa
accacggcttcctattttacagaagctattttaaatgaggctcgtccacgacacatcgcg
cttttttctacaattgatacggttgttggccctgagtccgatcagcgtttcaagtctaat
ctgacaacgccagagagcctcgatcttttccgcgatatgcgcgaggctgtcgaaaacggt
atgacccatctcgtgatggaagtgtcgagtcaggcatatttgcgcaatcgcgtttttgga
ttgacgtatgacgtcggcttcttcctgaacattacgccagatcacatcggaccgaatgaa
catccaacctttgctaattacttacacaacaagctgcaattgttggtcaatgcgcgcaaa
gtggtcattaatgccgaaaccgagcattttgaccaggtttatgctgccgcaacgaccacc
acttatccagaaagcatctacctgtttgccagtgctggcttcagacctaaacgcgatgat
atcgatattgattttcgctttgatagtcaggaagctgacgttgctgagagtcgtttcact
ttagtaccagtcacggaaaaagcagcagcattgaacatcggcggtcactactcgcttgct
ttgattggtgattttaacgaaagtaacgcgacggctgctattattggtgctggattggct
ggcgtggatgcatctgccgctgttccgggtattgcaaaagttaaaatccccggccgcatg
gagcatacgaaagttgccggacatggtgctgtctatgttgattatgcgcacaactacgct
agtatgaaggcgttattgtcgtttttgaaacacgcttacaaggatcctcgattactggtt
gtggttggatcccccggtgataaaggtgtttctcgtcgtcccggatttgctaaggttctc
actgagtttgcaactgaggcattcttgactaccgacgatcctgggtacgaagatccagca
aacatcattgaggaaatcgatagtaaaatcgatcatagcaaagttaaagtacacaaagtg
cttgatcggcaaaaggccattgctgaagctattagcgacagcagaccaaatgatatcgtg
gtggtggctggcaaaggggccgacccctatcaaaaggtacgcggcgtcaacacaccatgg
ccaacagacatggctgttgtaaagcaagtcgctaaatcgctacaggaaggctga

DBGET integrated database retrieval system