KEGG   Lactobacillus casei LC2W: LC2W_0275Help
Entry
LC2W_0275         CDS       T01956                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
lce  Lactobacillus casei LC2W
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lce00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LC2W_0275
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LC2W_0275
Enzymes [BR:lce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     LC2W_0275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
288858..290567
Genome map
AA seq 569 aa AA seqDB search
MKKHGFRFWLLAIVGLLGMVLSLSQPPKQVAAADNTLKSVFSIDAGRKFFSADQLKMIID
RAHTDGYTDVQVLLGNDALRLLLDDMSVTINGKTYGSDVVKQAIQAGNKAYYDDPNGNAL
TQTDMDAVLKYAAARDINIIPVINSPGHMDAILTAMAQLGIKNPAFNGSKRTVDLNNDTA
IAFTKALLQKYVMYFKGHATIFNFGSDEYANDVDTGGWAKLQQSGTYKKFVAYVNDLAAM
AKNASLKPMVFNDGIYYDNNTSFGTFDKDLIVSYWTAGWGGYDVAKPEFLTDKGLKIMNT
NDGWYWVLGRVDGDLYSYKTALASLASKKFTDVPGASSAVPIIGSVQAVWADDPSAQLDM
PALLKLMDQFSTAYAPYLVRPADYSKVDAAIAAVPRQLNQYTEASVAKLDAALNAVVRGK
KATDQALVDGYAQTITVAIKALQLRPADYTKVDAAIAAAKKLDRSHYQDLSAVDAALAAV
NRNLSITQQAQADTMAAKITAAIAALVLKPAPQPDPRQQQVPTKTIVNPDRYLPKTAEAS
GWELMLAGLATIFGVISIVFFWRQHRMAV
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagcacgggtttcgattttggttattggcgattgttggactgctgggtatggtg
ttgagtctgagtcagccgcccaagcaggtagctgctgctgataacaccttgaaaagcgtt
ttttcgattgatgcgggacgaaagtttttttccgcggatcagttgaaaatgatcattgat
cgggcacatacagacggttacaccgatgtgcaggttttattgggcaacgatgcattgcga
ttgctacttgatgacatgagcgtgacgatcaatggcaaaacatatggcagtgatgtcgtg
aaacaggccatacaggctggtaacaaagcgtactacgatgatccaaacgggaatgcgttg
acgcaaaccgacatggatgcggtcttgaaatatgcagcggcacgggatatcaatatcatt
ccggttatcaatagtcccggccatatggatgccattttgacggcgatggcgcaactaggc
attaagaatcctgcctttaatgggtctaaacggactgtcgatcttaacaatgacactgct
attgcctttacaaaagcgctattgcagaagtatgtgatgtatttcaaggggcatgctacg
atcttcaactttggcagtgacgagtatgcaaatgatgtcgatactggcggctgggccaag
ttgcaacaaagtggcacctacaaaaagtttgtggcatacgtcaacgacttagcggcgatg
gccaaaaatgccagcctgaagccgatggttttcaatgacgggatttattatgacaataac
accagtttcgggacttttgacaaggatttgatcgtctcttattggaccgctggctggggc
gggtatgatgtcgcaaagccagaatttttgaccgataagggtttgaaaatcatgaatacc
aatgacggttggtattgggttttaggtcgcgtggacggcgatctctatagttacaaaacg
gcgctagctagtttagcaagtaaaaaatttactgatgtacccggcgcttcgagtgccgtg
ccgattattggcagtgtgcaggcggtttgggcggatgatccgagtgcacagttagacatg
ccggcgctgttgaagttgatggatcaattttcgacagcctatgcaccttacttagttcgc
ccagccgattacagtaaagttgatgccgccatcgctgccgtgccgcggcaacttaatcag
tacaccgaagcatcagttgctaaacttgatgcagcgttaaatgctgttgtccgcggtaaa
aaggcaaccgatcaggcattggttgacggctatgcccagaccattactgtcgccatcaag
gcactgcaactgcggccggccgattacacaaaggttgatgccgccattgcagctgcaaag
aaacttgaccggtcacactatcaagaccttagtgccgttgatgcggcgcttgctgctgtt
aatcgtaatctcagcatcacccagcaagcccaagctgataccatggctgccaagattaca
gctgccatcgctgcgttggttctgaagccggcgccgcaacccgatccaaggcagcagcaa
gtgccaacaaaaaccattgtgaatccagaccggtatttaccaaaaacggcagaagcttcc
gggtgggaattgatgctagctgggcttgccacgatttttggtgtcattagcattgttttc
ttttggcggcaacatcgcatggccgtctaa

DBGET integrated database retrieval system