KEGG   Lactobacillus casei LC2W: LC2W_0280Help
Entry
LC2W_0280         CDS       T01956                                 

Definition
galactosidase, beta 1-like protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
lce  Lactobacillus casei LC2W
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lce00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
295614..297410
Genome map
AA seq 598 aa AA seqDB search
MTTFSIDHEFMLDGQPFKILSGAIHYFRVHPSDWYHSLYNLKALGFNTVETYVPWNLHEY
NEGDFDFSGILDIERFLNTAKDLGLYAIVRPSPYICAEWEFGGFPAWLLTKKMRLRTDDP
AYLQAIDRYYTALMPHLVGHQVTHGGNVIMMQVENEYGSYGEDKDYLAAVAELMKKHGVD
VPLFTSDGPWPATLNAGSMADAGILTTGNFGSRADMNFDRLAAFNQAHGHDWPLMCMEFW
DGWFNRWGEPIIRRDPEETAEDLRAVIQRGSVNLYMFHGGTNFGFMNGTSARKDHDLPQV
TSYDYDAPLNEQGNPTPKYFTIQKMIHEVLPSQAQTTPLVKPAMRQADNPLTAKVSLFSV
LDQLAQPVAAPYPQTQEFLGQYTGYTLYRTNPLISGTDKGTPAKLRVIDARDRVQAFFDG
KSLATQYQEAIGDDILLPEVEGRHQLDLLVENMSRVNYGSKIEAITQFKGIRTGVMVDLH
FIKDYLQYPLDLNKAPQLDFTGDWQAGTPAFYQYGFDVVKPQDTYLDCRGFGKGVMLVNG
VNIGRFWGKGPTLSLYVPAGLLHTGHNEVIVFETEGQYAEAINLVDHPIFKELNTEEE
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccttttcgatcgatcatgagtttatgttggacggtcagccgttcaagattctg
tctggcgcgattcattacttccgagtccatcccagtgattggtatcacagcctttataac
ttgaaggcactgggatttaacacggtagaaacctatgtcccttggaatctgcacgagtac
aacgaaggtgactttgatttcagcgggattctcgacattgaacgctttctaaacaccgca
aaggatcttggcttatatgccatcgtgcgaccatccccttacatctgcgcagaatgggag
ttcggcgggtttccagcatggctgttaacgaaaaagatgcgcttgcgaaccgacgatcct
gcctatctgcaagcgattgaccgatactacacagctttaatgcctcatcttgtgggtcat
caagtcacgcatggtggcaatgtcatcatgatgcaagtggaaaatgagtacggttcatat
ggcgaagacaaggactatcttgccgccgtggccgaacttatgaaaaagcatggcgttgat
gtcccgctttttacctcggatggtccctggccagcaaccttgaacgctggcagcatggcc
gacgctggtattttgactaccggcaattttggctcacgtgccgacatgaatttcgatcgg
ttggcggccttcaatcaagctcatggacatgattggccgttgatgtgtatggaattctgg
gacggctggttcaaccgctggggcgaaccgatcattcgccgcgacccagaagaaactgcc
gaggacttgcgagcggtgatccaacgcggcagtgtcaatctctacatgttccacggggga
actaattttggctttatgaacggtacctcagctcgcaaagatcatgatctaccgcaagtg
acttcctacgattacgatgcaccattgaatgagcaaggcaatccaacgccaaagtacttt
accattcagaaaatgatccacgaagtcttgccatcgcaggcccagaccacaccgctggtc
aagccagcgatgaggcaagcggacaatccgttgacggcgaaagtgtcattattctcagta
cttgatcagctagctcagccagtagccgcaccttatccgcagacacaggagtttcttggc
caatacaccggttatacgttgtatcgaacaaacccgctgatcagtggtaccgacaaaggc
acgccggctaagttgcgcgtgattgatgcccgtgatcgggttcaagccttctttgatggc
aagtcgctagcaacacagtatcaagaggccatcggcgatgacatcctgctcccagaagtt
gaaggccgccatcaactagatctgttggtcgaaaacatgagccgcgtcaactacggctca
aaaatcgaagcgattacccagtttaagggaattcgcaccggtgtcatggtagacctccat
ttcattaaggactacctgcaatacccacttgacttgaacaaggcgccgcaacttgatttc
accggcgattggcaagcagggacacccgctttttatcaatatgggtttgatgtggtgaaa
ccacaagatacgtatcttgattgtcgtggatttggtaaaggagtgatgctggtcaatggt
gttaacatcggcagattctgggggaaggggccaacgttgtcactatatgtgccagccggg
ttgcttcacaccgggcacaatgaggtcattgtttttgaaaccgaaggccaatatgccgag
gcgataaacttggttgaccacccaatatttaaggaactgaacacagaggaggaataa

DBGET integrated database retrieval system