KEGG   Lactobacillus casei LC2W: LC2W_0729Help
Entry
LC2W_0729         CDS       T01956                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lce  Lactobacillus casei LC2W
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lce00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LC2W_0729 (glpK)
Enzymes [BR:lce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LC2W_0729 (glpK)
Exosome [BR:lce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LC2W_0729 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(723126..724643)
Genome map
AA seq 505 aa AA seqDB search
MTSDQKYILAIDEGTTSTRTIIIDHNGQKVVDAQREFPQYFPHPGWVEHNANEIWNAALS
TIATAFIESQIQPRQIVGIGITNQRETTVVWDKQTGLPIYNAIVWQSRQTSEIADKLKAD
GHSDMIHDSTGLLIDSYFSATKIRWILDHVPGAQERAEKGELLFGTIDTWLSWKLSGGAI
HVTDYTNASRTMLFNIHKLAWDDEILQLLNIPKQMLPEVRSNSEIYGNAAAYHFFGSTVP
IAGMVGDQQAALFGQLALEPGMVKNTYGTGAFIVMNTGEKPTLSNNNLLTTIGYGLDGKV
TYALEGSVFVAGSAIQWLRDAMKLVERSSDSEAAARASKSQNEVYVVPAFTGLGAPYWDS
DARGAIFGITRGTTREDFIKATLQSLAYQSRDVVDTMNKDTGIPIQALRVDGGAANNDYL
MQFQADILGIPIERAANLETTAMGAAFLAGLATGFWNNTDELQSIVKLGKRFEPTMGAPD
RDHLYEGWQQAVAATQMYKHKAKKA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtgacaagtgatcagaagtacattctggcgattgatgagggtaccacgagtacacggacc
atcatcatcgatcacaatggtcaaaaagttgttgatgcacagcgggaatttccgcagtat
tttccgcatccgggatgggtcgagcataatgccaatgaaatttggaatgccgctttgtcg
accatcgcgacggcgtttattgaatcacagattcagccacgccaaattgtcggaatcggg
attaccaatcaacgggaaaccacggttgtatgggacaaacagaccgggttgccaatctac
aacgccatcgtctggcagtcgcggcaaactagcgagatcgctgacaaacttaaggcagat
ggccacagcgatatgattcatgattcaaccggtttgctaattgattcgtatttctcagcg
actaagattcgctggattttggatcatgtgcctggcgcgcaagaacgggcggaaaaaggc
gaactgcttttcggcaccatcgatacttggctttcttggaagctgtccggcggcgccatt
catgtcaccgactataccaacgcctcacgaaccatgttgttcaacatccataaactagcc
tgggatgacgagattctccaattgttgaatattcctaagcaaatgctaccggaagttcgc
agcaattcagaaatttacggcaatgcagcagcctatcatttcttcggcagtaccgtgcca
attgccggcatggttggtgaccaacaagcagcactttttggtcagttggcgcttgagccg
ggcatggtgaaaaacacctatggcacaggtgcattcattgtgatgaataccggcgaaaaa
ccgaccttgtccaacaacaacctgctcaccaccatcggctatggacttgatggcaaggtg
acctatgcacttgaaggttccgttttcgttgccggcagtgcgattcaatggttgcgggac
gccatgaagttggtcgagcgttcaagcgactccgaagccgccgcacgggcttctaagagt
caaaatgaagtttatgttgtcccagccttcacaggcttaggtgcgccttattgggattct
gatgctcgcggtgctatttttggcatcactcgtggcacgactcgcgaagatttcatcaaa
gcaaccttgcaatctcttgcttatcagtcacgtgatgtcgtggataccatgaataaagac
actggtatcccgatccaagctttgcgcgttgacggcggcgcagctaacaacgattacctg
atgcaattccaagcagatattttaggcattccgattgaacgagcagccaatttggaaacg
acggcaatgggcgctgccttcctcgctggtttggcgactggcttctggaacaataccgat
gaactgcaaagtatcgtgaagcttggcaaacgttttgaaccaacaatgggcgcgcctgat
cgcgaccacctttatgaaggctggcagcaagctgttgctgcaacccaaatgtataagcac
aaggcgaagaaagcctga

DBGET integrated database retrieval system